KEGG   Helicobacter pylori Aklavik86: HPAKL86_02810Help
Entry
HPAKL86_02810     CDS       T02353                                 

Definition
(GenBank) type I restriction enzyme R protein
  KO
K01153  type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
hpyk  Helicobacter pylori Aklavik86
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:hpyk02048]
    HPAKL86_02810
Enzymes [BR:hpyk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     HPAKL86_02810
Prokaryotic defense system [BR:hpyk02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   HPAKL86_02810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EcoR124_C SWI2_SNF2 HSDR_N ResIII DEAD
Motif
Other DBs
NCBI-ProteinID: AFX89572
UniProt: K7YMK9
Position
582847..585828
Genome map
AA seq 993 aa AA seqDB search
MNYEIIAESNESTVIAEYHSDNDKKSAYESEAELERAFIALLQKQGYEFKKIHKEQELKD
NLKEQLEKLNDYYFTPKEWETLYSQFIANKNDDYKAKTRKIQEDPIFNLTLENGKTKNIK
IIDKKNIHKNALQVIHQYSAKGKYENRYDVSILVNGLPLVHVELKRRGVAIREAFNQIKR
YKRDSFSAEDGLFDFVQIFVISNGTSSKYYSNTTRIAQLEKNHKADTFEFTNYWADSKNN
NIEDLMDFARSFFAKHSLLNVLTRYCVFTSDEVLLVMRPYQIVAAERILEKIKTAQNSKT
YGKSQSGGYIWHTTGSGKTLTSFKSAVLAKELESVSKVLFVVDRKDLDYQTMKEYDKFQK
DCANSNISTRILKEQLENPNAKIIITTIQKLDKFVKSHLKGHAIFNEEVVMIFDECHRSQ
LGSMHQAITKAFKKYYLFGFTGTPIFAQNCDKNNPLGTTDQKFGNCLHQYTIIDAIRDKN
VLPFRVEYHNTIKAKEGIIDNKVRAVDEKNALLDTRRIKEITKCILERFNQATKNKKFNS
ILACSSIEALKKYYMAFKEEKHDLKIATIFSYSANEELDMLEDENNESANALDTSSRDFL
EGAIADYNGMFKTSFDTSDQKFQSYYKDLSQKVKDREIDLLMVVNMFLTGFDATRLNTLW
VDKNLKYHGLIQAFSRANRILDSVKTHGNIVCFRDLEQDLNDALMLFGNKDAKSIALLRK
YEDYLKGYTDNNKEYEGYEGLIERLLREFPLKEPIISESQKKDFIKLFGKILKLENILNS
FENFKKDDYIKARDFQDYQSKYLDFYDEMRPEKGRDKEEINDDLIFEIELIKQVEVNIDY
ILNLIEEFAKEHGVEIQGVKTKIEPIINSSIELRNKKDLIMDFIDKYNKDQEVHAYFQDY
IHQKREEEFQNIIEENRLNEEKAYSFMQHAFKGGEISFSGTEFPKIIEEKPSRFDKNSRY
QEVKEKVAASLSRFFHRFFDLTSSIFKKNEIKK
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgaaattatcgcagaaagcaatgaaagcaccgtgatagccgagtatcatagc
gataatgacaaaaaaagcgcttatgagagcgaagcagagctagaaagggcgtttatagcg
cttttacaaaaacaaggctatgaatttaaaaaaatccacaaagaacaagaattaaaagac
aacttaaaagagcagttagaaaagcttaacgattattatttcacgcctaaagaatgggag
actctttattctcaattcatcgctaataaaaatgatgattataaggctaaaacgagaaaa
atccaagaagatccgatttttaatctcacgctagagaatgggaaaaccaaaaacattaaa
atcattgataagaaaaatatccataaaaacgctctgcaagtgatccaccaatacagcgct
aaagggaagtatgagaaccgctatgatgtgagtatccttgtgaatggcttgcctttagtg
catgtggaattgaaaagaagaggcgtggcgattagagaggcgttcaatcaaatcaagcgc
tataaaagggatagttttagcgctgaagacgggctttttgatttcgtgcagatttttgtt
atcagtaacggcacgagctctaaatactattcaaacaccacaagaatagcccagctggaa
aaaaaccataaagccgatacttttgaattcactaattattgggcggatagcaagaataac
aatattgaagatttaatggattttgcccggtcgttttttgcaaagcatagccttttgaat
gttttaacgcgctattgcgttttcacaagcgatgaggttttattggtgatgcggccttat
caaatcgtggcggccgaaaggattttagaaaaaatcaaaaccgcgcaaaatagtaaaact
tatgggaaaagtcaaagcggaggctatatctggcacacgacagggagcggtaaaacctta
acgagctttaaaagcgcggttttggctaaagaattagagagcgtttcaaaagtcttattt
gtggtggatagaaaggatttggactatcaaaccatgaaagaatacgataaattccaaaaa
gattgcgccaattccaacataagcaccaggattttaaaagaacagcttgaaaaccctaac
gctaaaatcattatcaccacgatccaaaaattagacaaattcgttaaatcccaccttaaa
gggcatgcgatctttaatgaagaagtggtgatgatttttgatgaatgccataggagtcag
ttaggctccatgcatcaagccatcactaaagcgtttaaaaaatactacctttttgggttc
acgggcacgcccatttttgcacaaaattgcgataaaaacaaccctttaggcacgacagat
cagaaatttgggaattgcctccaccaatacaccattattgatgcgatcagggataaaaat
gttttaccctttagagtggaataccacaacaccattaaagctaaagagggcattatagat
aataaggttagagcggttgatgaaaaaaacgcccttttggataccaggaggatcaaagaa
attactaaatgcattttagagcgtttcaatcaagccactaaaaataaaaaattcaattcc
attctggcatgctctagtatagaagcgctgaaaaaatactacatggcttttaaagaagaa
aaacacgaccttaaaatcgctaccatttttagctatagcgctaatgaagaacttgacatg
ttagaagatgaaaacaatgaaagcgctaacgccctagacacaagctcaagggatttttta
gagggcgcgattgcggattataatggaatgtttaaaacttcttttgacacttcggatcaa
aaattccaaagctattataaggatctttctcaaaaagtaaaggatcgtgaaatcgatctt
ttaatggtggttaatatgtttttgaccgggtttgacgctacaaggcttaacaccctttgg
gtggataaaaacctcaaataccatgggctaattcaggctttttcacgcgcaaaccgcatt
ttagatagcgttaaaacgcatgggaatatcgtgtgttttagggatttagagcaggattta
aatgacgctctcatgctttttggcaacaaggacgctaaatctattgcgctattaaggaaa
tatgaagattatttgaaaggctacacggataataataaagaatacgagggctatgagggt
ttgattgaaaggcttttaagagaatttcccttaaaagagccgattatttcagaaagtcag
aaaaaggatttcattaagctttttggcaagattttgaaattagaaaatattttaaacagc
tttgaaaattttaaaaaagacgattacatcaaggcgagagattttcaagactatcaaagc
aaataccttgatttttacgatgaaatgaggccagaaaaagggagggataaagaagagatt
aacgacgatttgatctttgaaattgaactcattaagcaagtggaagtcaatattgactat
attttgaatttgattgaagagttcgctaaagagcatggggtagaaattcaaggcgttaaa
accaaaatagagccaatcatcaactccagcatagagttaaggaataaaaaagatttgatc
atggatttcattgacaaatacaacaaagaccaggaagtccatgcgtattttcaagattat
atccaccaaaaaagagaagaggaattccaaaatatcatagaagaaaaccgcttgaatgaa
gaaaaagcctattcgttcatgcagcatgcctttaaagggggcgaaatcagcttcagcggg
acggaattccctaaaatcattgaagaaaaaccctccaggtttgacaaaaattcgcgctat
caagaggtgaaagaaaaagtcgctgcaagcctttctcgttttttccaccgcttttttgat
ctcactagttctatatttaagaaaaatgagattaaaaaataa

DBGET integrated database retrieval system