KEGG   Helicobacter pylori Aklavik86: HPAKL86_03635Help
Entry
HPAKL86_03635     CDS       T02353                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
hpyk00071  Fatty acid degradation
hpyk00072  Synthesis and degradation of ketone bodies
hpyk00280  Valine, leucine and isoleucine degradation
hpyk00310  Lysine degradation
hpyk00362  Benzoate degradation
hpyk00380  Tryptophan metabolism
hpyk00620  Pyruvate metabolism
hpyk00630  Glyoxylate and dicarboxylate metabolism
hpyk00640  Propanoate metabolism
hpyk00650  Butanoate metabolism
hpyk00900  Terpenoid backbone biosynthesis
hpyk01100  Metabolic pathways
hpyk01110  Biosynthesis of secondary metabolites
hpyk01120  Microbial metabolism in diverse environments
hpyk01130  Biosynthesis of antibiotics
hpyk01200  Carbon metabolism
hpyk01212  Fatty acid metabolism
hpyk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPAKL86_03635
   00630 Glyoxylate and dicarboxylate metabolism
    HPAKL86_03635
   00640 Propanoate metabolism
    HPAKL86_03635
   00650 Butanoate metabolism
    HPAKL86_03635
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPAKL86_03635
   00072 Synthesis and degradation of ketone bodies
    HPAKL86_03635
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPAKL86_03635
   00310 Lysine degradation
    HPAKL86_03635
   00380 Tryptophan metabolism
    HPAKL86_03635
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPAKL86_03635
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPAKL86_03635
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPAKL86_03635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpyk04147]
    HPAKL86_03635
Enzymes [BR:hpyk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPAKL86_03635
Exosome [BR:hpyk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPAKL86_03635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFX89737
UniProt: K7YN23
Position
746350..747525
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAIGSFLGSLKSVGAREMGAVVLKDALNASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGHGEVVVCGGVENMSM
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASVIILCSAQKAQKLGLKAMATIKGFGLGACSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHGVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctatagggagttttttaggctct
ctaaaaagcgtgggcgctagagaaatgggcgctgttgtgcttaaagacgctttgaatgcg
agtggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaactagacgctggcatccctaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcatggtgaggtggtggtgtgcggtggcgtggaaaacatgagcatg
gcaccctatctgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gattccatgatccatgatggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggtgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtgttatcattttatgcagtgct
caaaaagcgcaaaaattggggttaaaagcaatggcaactatcaaggggtttggtttgggc
gcttgcagtccggatatcatggggatatgccctagtatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagccttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggtgcaagcggcgctaggattttggtaacttta
ttgcatgaaatgaaaagaagcgctcatggcgtgggctgcgcgtcattgtgtgtgggtggc
ggacaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system