KEGG   Helicobacter pylori OK310: HPOK310_0099Help
Entry
HPOK310_0099      CDS       T02542                                 

Definition
(GenBank) hypothetical protein
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hpyl  Helicobacter pylori OK310
Pathway
hpyl00020  Citrate cycle (TCA cycle)
hpyl00620  Pyruvate metabolism
hpyl01100  Metabolic pathways
hpyl01110  Biosynthesis of secondary metabolites
hpyl01120  Microbial metabolism in diverse environments
hpyl01130  Biosynthesis of antibiotics
hpyl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpyl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPOK310_0099
   00620 Pyruvate metabolism
    HPOK310_0099
Enzymes [BR:hpyl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HPOK310_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Lycopene_cycl Pyr_redox FAD_binding_2 Thi4 PEX-1N K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAM97527
UniProt: M4ZLL2
Position
complement(97469..98821)
Genome map
AA seq 450 aa AA seqDB search
MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSI
ETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEECEFMKKRYESFKE
IFVGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYQKDWSTMNFAKLSENFVKEALK
LKPNNQVFLNFKVKKIEKRKDTYAVISEDAEEVYAKFVLVNAGSYALPLAQSMGYGLDLG
CLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALTMPKLERNK
CWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVFKNMVFELPIIGKRKFLKDAQKII
PSLSLEDLEYAHGFGEVRPQVLDRTKRKLELGEKKICTHKGVTFNMTPSPGATSCLQNAL
VDSQEIAAYLGESFELERFYKDLSPEELES
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaatttgatgctgtgattattggaggtggggtttcagggtgcgcgaccttt
tatactttgagcgaatacagctctctaaagcgcgtggctatcgtagaaaaatgctctaaa
ttagctcaaatcagctctagtgctaaggctaattcacaaaccattcatgatggctctatt
gaaacgaattacactcccgaaaaagctaaaaaagtgcgtttgagcgcttataaaaccagg
caatacgcgctcaataaaggcttgcaaaatgaagtcatttttgaaacccagaaaatggct
ataggcgtgggcgatgaagaatgcgagttcatgaaaaaacgctatgaatcctttaaagaa
atctttgtggggttagaagaatttgacaaacaaaagattaaagaattagagcctaatgtg
attttaggggctaatggcatagacaggcatgaaaacattatcgggcatggttatcaaaaa
gattggagcacgatgaattttgcgaagttgagtgaaaacttcgttaaagaagccctaaaa
ttaaagcctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaaa
gacacttacgccgtaatttctgaagacgctgaagaagtgtatgctaaattcgtgctggtc
aatgccggctcttacgctttacctttggctcagagcatgggctatggcctggatttaggg
tgcttgcctgtggcgggtagcttttattttgtgccggatttattaaggggtaaggtttat
accgttcaaaaccctaaactcccttttgcagccgtgcatggcgaccctgatgccgtcatt
aaaggaaaaacacgaatcgggcctaccgctttaacgatgcctaaattagaacgcaacaaa
tgctggcttaagggcattagcttggaattgttgaaaatggatttgaataaagatgtgttt
aagattgcgtttgatttgatgagcgataaggaaatccgtaattatgtgtttaaaaacatg
gtttttgaattgcccattatcggtaaaaggaaatttttaaaagacgctcaaaaaatcatc
ccctctcttagcctagaagatttagaatacgctcatggttttggcgaagtgcgcccgcaa
gttttagacagaaccaagcgaaagctggaattaggcgaaaaaaagatttgcacccataaa
ggcgtcacttttaacatgaccccctctccaggtgcgacgagttgcttgcaaaacgccctt
gtggattcccaagaaatcgctgcgtatttgggcgagagctttgaattagaacgcttttat
aaagatttatccccagaagaattggaaagttaa

DBGET integrated database retrieval system