KEGG   Helicobacter pylori OK310: HPOK310_0680Help
Entry
HPOK310_0680      CDS       T02542                                 

Gene name
thl
Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyl  Helicobacter pylori OK310
Pathway
hpyl00071  Fatty acid degradation
hpyl00072  Synthesis and degradation of ketone bodies
hpyl00280  Valine, leucine and isoleucine degradation
hpyl00310  Lysine degradation
hpyl00362  Benzoate degradation
hpyl00380  Tryptophan metabolism
hpyl00620  Pyruvate metabolism
hpyl00630  Glyoxylate and dicarboxylate metabolism
hpyl00640  Propanoate metabolism
hpyl00650  Butanoate metabolism
hpyl00900  Terpenoid backbone biosynthesis
hpyl01100  Metabolic pathways
hpyl01110  Biosynthesis of secondary metabolites
hpyl01120  Microbial metabolism in diverse environments
hpyl01130  Biosynthesis of antibiotics
hpyl01200  Carbon metabolism
hpyl01212  Fatty acid metabolism
hpyl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpyl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPOK310_0680 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    HPOK310_0680 (thl)
   00640 Propanoate metabolism
    HPOK310_0680 (thl)
   00650 Butanoate metabolism
    HPOK310_0680 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPOK310_0680 (thl)
   00072 Synthesis and degradation of ketone bodies
    HPOK310_0680 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPOK310_0680 (thl)
   00310 Lysine degradation
    HPOK310_0680 (thl)
   00380 Tryptophan metabolism
    HPOK310_0680 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPOK310_0680 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPOK310_0680 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPOK310_0680 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpyl04147]
    HPOK310_0680 (thl)
Enzymes [BR:hpyl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPOK310_0680 (thl)
Exosome [BR:hpyl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPOK310_0680 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAM98108
UniProt: M4ZNZ0
Position
696687..697862
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALKASGLEPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDAIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARSAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASVIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHGVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtggggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgctgtcgtgcttaaagacgctctgaaagcg
agcggtcttgagccaagcgatgtggattctgtcattttaggcaatgttttatccgctggt
ttgggtcaaaatattgccaggcagatccaactggacgcgggcataccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcacatgat
gccatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaatatgagtgca
gcgccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgccaacatgata
gactccatgatccatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagatctgccattaatgcagggaaatttcaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacactagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtgttatcattttatgcagcgct
caaaaagcgcaaaaattagggttaaaaacaatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagtattgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagctttcgccgcg
caaagcatagccgtgttaaaagagcttgagttaaaccccaatatcgtgaatgtgaatgga
ggtgcgatagccattggccaccctattggcgcaagcggtgctaggattttggtaacttta
ttgcatgaaatgaaaagaagcgctcatggcgtgggctgcgcgtcattgtgtgtgggcggc
ggacaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system