KEGG   Helicobacter pylori UM299: K749_02165Help
Entry
K749_02165        CDS       T02661                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpym  Helicobacter pylori UM299
Pathway
hpym00071  Fatty acid degradation
hpym00072  Synthesis and degradation of ketone bodies
hpym00280  Valine, leucine and isoleucine degradation
hpym00310  Lysine degradation
hpym00362  Benzoate degradation
hpym00380  Tryptophan metabolism
hpym00620  Pyruvate metabolism
hpym00630  Glyoxylate and dicarboxylate metabolism
hpym00640  Propanoate metabolism
hpym00650  Butanoate metabolism
hpym00900  Terpenoid backbone biosynthesis
hpym01100  Metabolic pathways
hpym01110  Biosynthesis of secondary metabolites
hpym01120  Microbial metabolism in diverse environments
hpym01130  Biosynthesis of antibiotics
hpym01200  Carbon metabolism
hpym01212  Fatty acid metabolism
hpym02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K749_02165
   00630 Glyoxylate and dicarboxylate metabolism
    K749_02165
   00640 Propanoate metabolism
    K749_02165
   00650 Butanoate metabolism
    K749_02165
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K749_02165
   00072 Synthesis and degradation of ketone bodies
    K749_02165
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K749_02165
   00310 Lysine degradation
    K749_02165
   00380 Tryptophan metabolism
    K749_02165
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K749_02165
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K749_02165
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    K749_02165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpym04147]
    K749_02165
Enzymes [BR:hpym01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K749_02165
Exosome [BR:hpym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K749_02165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGL67825
Position
1479460..1480635
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALNASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDVFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGVSIIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSIVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtggggagttttttaggctct
ctaaagagcgtgggtgctagagaaatgggtgctgtcgtgcttaaagacgctttgaatgcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaattagacgctggcatcccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaatatgagtgca
gcgccttatttgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattatgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgttttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaatttcaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgtgagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaaccatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagctttcgccgcg
caaagcatagccgtattaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggtgcgatagccattggccaccctattggtgcgagcggcgctaggattttagtgacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggctgcgcgtcattgtgtgtgggcggc
ggacaagggctatcaatagtagtggaacaaaaataa

DBGET integrated database retrieval system