KEGG   Helicobacter pylori UM299: K749_03240Help
Entry
K749_03240        CDS       T02661                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
hpym  Helicobacter pylori UM299
Pathway
hpym00380  Tryptophan metabolism
hpym00630  Glyoxylate and dicarboxylate metabolism
hpym01110  Biosynthesis of secondary metabolites
hpym01130  Biosynthesis of antibiotics
hpym01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpym00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    K749_03240
  Amino acid metabolism
   00380 Tryptophan metabolism
    K749_03240
Enzymes [BR:hpym01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     K749_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel YscO
Motif
Other DBs
NCBI-ProteinID: AGL68029
Structure
PDB: 

Position
complement(79132..80649)
Genome map
AA seq 505 aa AA seqDB search
MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGS
GAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTE
EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNPDMVWDFWSSVPESLYQVTWV
MSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEIRKHDPD
SNQRDLFDAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLKDYPLMEVGIVELN
KNPENYFAEVEQAAFTPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPR
CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRA
DDSDYYTQPGDYYRSLPADEKERLYDTIGGSLAHVTHKEIVDKQLEHFKKADPKYAEGVK
KALEKHQKMMKDMHGKDMHHMKKKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttaataaagatgtgaaacaaaccactgcttttggcgctcccgtttgggatgataac
aatgtgattacggctggccctagaggtcctgttttattacaaagcacttggtttttggaa
aagttagcggcgtttgatcgagaaaggattcctgaaagggtggtgcatgctaaaggaagc
ggagcttatggcactttcaccgtgactaaagacatcactaaatacactaaagcgaaaatt
ttctctaaagtgggcaaaaaaacagaatgctttttcagattctctactgtggctggtgaa
agaggcagtgcggatgcggtgagagaccctagaggttttgcgatgaagtattacactgaa
gaaggtaactgggatttagtagggaacaacacgcctgttttctttatccgtgatgcgatc
aaattccctgatttcatccacactcaaaaacgagaccctcaaaccaatttgcctaacccc
gacatggtgtgggatttttggagtagtgttcctgaaagcttataccaagtaacatgggtt
atgagcgataggggtattcctaaatctttccgccacatggatggttttggcagccacact
ttcagccttatcaatgcgaaaggcgaacgcttctgggtgaaattccactttcacaccatg
caaggcgttaagcacttgactaatgaagaagccgcagaaatcagaaagcatgatcctgat
tccaatcaaagggatttattcgatgcgatcgctagaggggatttcccaaaatggaaattg
agcattcaagtgatgccagaagaagatgctaaaaagtatcgattccatccgtttgatgtg
actaaaatttggtatctcaaagattatccgttgatggaagtgggcattgtagagttgaat
aaaaatcctgaaaactatttcgcagaagtggagcaagcggcattcactccggctaatgtc
gttcctgggattggctatagccctgataggatgttacaagggcgcttgttctcttatgga
gacacacaccgctaccgcttaggcgttaattatcctcaaataccggttaataaaccaaga
tgcccgttccactcttctagcagagatggttacatgcaaaacggatactacggctcttta
caaaactatacgcctagctcattgccaggttataaagaagataagagtgcgagggatcct
aagttcaacttagctcatattgagaaagagtttgaagtgtggaattgggattacagagct
gatgatagcgattactacacccaaccaggtgattactaccgctcgttgccagctgatgaa
aaagaaaggttgtatgacactattggaggatctttagctcatgttacccataaagaaatt
gtggataaacaattggagcatttcaagaaagctgaccccaaatacgctgagggagttaaa
aaagctcttgaaaaacaccaaaaaatgatgaaagacatgcatggaaaagacatgcaccac
atgaaaaagaaaaagtaa

DBGET integrated database retrieval system