KEGG   Helicobacter pylori OK113: HPOK113_0702Help
Entry
HPOK113_0702      CDS       T02510                                 

Gene name
thl
Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyo  Helicobacter pylori OK113
Pathway
hpyo00071  Fatty acid degradation
hpyo00072  Synthesis and degradation of ketone bodies
hpyo00280  Valine, leucine and isoleucine degradation
hpyo00310  Lysine degradation
hpyo00362  Benzoate degradation
hpyo00380  Tryptophan metabolism
hpyo00620  Pyruvate metabolism
hpyo00630  Glyoxylate and dicarboxylate metabolism
hpyo00640  Propanoate metabolism
hpyo00650  Butanoate metabolism
hpyo00900  Terpenoid backbone biosynthesis
hpyo01100  Metabolic pathways
hpyo01110  Biosynthesis of secondary metabolites
hpyo01120  Microbial metabolism in diverse environments
hpyo01130  Biosynthesis of antibiotics
hpyo01200  Carbon metabolism
hpyo01212  Fatty acid metabolism
hpyo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPOK113_0702 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    HPOK113_0702 (thl)
   00640 Propanoate metabolism
    HPOK113_0702 (thl)
   00650 Butanoate metabolism
    HPOK113_0702 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPOK113_0702 (thl)
   00072 Synthesis and degradation of ketone bodies
    HPOK113_0702 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPOK113_0702 (thl)
   00310 Lysine degradation
    HPOK113_0702 (thl)
   00380 Tryptophan metabolism
    HPOK113_0702 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPOK113_0702 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPOK113_0702 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPOK113_0702 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpyo04147]
    HPOK113_0702 (thl)
Enzymes [BR:hpyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPOK113_0702 (thl)
Exosome [BR:hpyo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPOK113_0702 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAM96610
UniProt: M4ZK35
Position
755380..756555
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALKASGLEPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
VPYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARVAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIRNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHSVGCASLCVGGGQGLSIVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagtgctgtggggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgctgtcgtgcttaaagacgctctgaaagcg
agcggtcttgagccaagcgatgtggattctgtcattttaggcaatgttttatccgctggt
ttgggtcaaaatatcgccagacagatccaattagatgcgggcataccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagtgca
gtgccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcaaacatgata
gactccatgatccatgatggattgtgggatgcattcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgcttttgcgctc
caatcgcaactcaaagcaagagtcgccattaatgcagggaaattccaagaagagatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgactctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaacaatggcaactatcaagggatttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattagaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagctttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcaatagccattggccaccctattggtgcaagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcgctcatagcgtgggttgcgcgtcattgtgtgtgggtggt
ggacaagggctatcaatagtagtggaacaaaaataa

DBGET integrated database retrieval system