KEGG   Helicobacter pylori UM032: K747_05895Help
Entry
K747_05895        CDS       T02658                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hpyr  Helicobacter pylori UM032
Pathway
hpyr00450  Selenocompound metabolism
hpyr00970  Aminoacyl-tRNA biosynthesis
hpyr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpyr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    K747_05895
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    K747_05895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpyr01007]
    K747_05895
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hpyr03016]
    K747_05895
Enzymes [BR:hpyr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     K747_05895
Amino acid related enzymes [BR:hpyr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   K747_05895
Transfer RNA biogenesis [BR:hpyr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    K747_05895
 Prokaryotic type
   Other AARSs
    K747_05895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e SAC3_GANP
Motif
Other DBs
NCBI-ProteinID: AGL66971
Position
1125634..1127577
Genome map
AA seq 647 aa AA seqDB search
MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAR
LRNQSPKAYADSISAIFKDQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGT
YSGYYCVSCESYCAISKTDNTNDKVLCPDCLRETMLLEEESYFFRLSAYEKPLLDFYAKN
PEAILPVYRKNEVTSFIEQGLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYAS
ALGYLNDLDNKMVHFACARHIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGV
KMSKSLGNVLDAQKIAMEYGIEELRYFLLREVPFGQDGDFSKKALVERINANLNNDLGNL
LNRLLGMAKKYFNHSLKSAKITAYYSKELEKVHQILDNANSFVPKMQLHKALEELFNVYD
FLNKLIAKEEPWVLHKNNESEKLEALLSLIANALLQSSFLLYAFMPKSAAKLASAFHAEI
TPDNYERFFKAKKLQDMILQDTEPLFSKIEKIEKAEKAEEVPLEKNEKEEKEKAPPKQEN
YISIEDFKKVEIKVGLIKEAQRIEKSNKLLRLKVDLGEGCLRQIVSGIALDYEPESLVGQ
MVCVVANLKPAKLMGEMSEGMILAVRDSDNLALISPTREKIAGSLIS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcactgatcacaactcccatttattatgtgaatgatatcccccatattggc
catgcttatacgactttgattgcggatactttaaagaagtattacacgcttcaaggcgaa
gaagtcttttttttaaccggcaccgatgagcatgggcaaaagatcgaacaaagtgcgaga
ttgagaaatcaaagccctaaagcttacgccgatagcattagtgcgatttttaaagaccag
tgggattttttcaatttagattatgatggttttatccgcaccacagacagcgagcatcaa
aaatgcgtgcaaaacgcctttgaaatcatgtttgaaaaaggggatatttataaaggcact
tatagcgggtattattgcgtgagctgtgagagttattgcgcgatctctaaaacggacaat
acgaatgataaagtcttatgtcctgattgcttgagagaaaccatgcttttagaagaagag
agttattttttcagattgagcgcgtatgagaagcctttattggatttttacgctaaaaac
cctgaagcgattttgcccgtttatcgtaaaaatgaggtaacttcttttattgagcagggt
ttattggatctgtctatcacgcgcacgagctttgaatggggcattcctttgcctaaaaaa
atgaacgatcctaaacatgtggtgtatgtttggctagacgctttattgaattatgcgagc
gcactagggtatttgaatgatttagacaataaaatggtgcattttgcatgcgctaggcat
attgtgggtaaggatattttacgcttccatgccatttattggccggcttttttgatgagt
ttgaatctgcccctattcaaacagctttgcgtgcatgggtggtggacgatagagggcgtg
aaaatgagtaagagcttgggtaatgttttagacgctcaaaaaatcgctatggagtatggg
attgaggaattacgctattttttattgcgtgaagtgccttttgggcaagatggggatttt
tctaaaaaagcgttagtagaaaggatcaatgcgaatttgaataacgatttggggaatttg
ttgaatcgcttgctaggcatggctaaaaaatatttcaaccattctctaaaaagcgcaaaa
atcaccgcatattattctaaagagctagaaaaagtgcatcaaattttagataacgctaat
tcttttgtgcctaaaatgcaattgcataaagctttagaagaattgtttaatgtttatgat
tttttaaacaaactcatcgctaaagaagagccatgggttttgcacaaaaacaacgaatca
gaaaaactagaagccttattgagtttgatcgcaaacgcgcttttacaatcaagctttttg
ctctatgcgttcatgccaaagagcgcggctaaattagcgagtgcttttcatgcagaaatc
acgcctgataattacgaacgcttttttaaagctaaaaaattacaagatatgattttacaa
gacaccgagcctttattttccaaaattgagaaaattgaaaaggctgaaaaagcggaagaa
gtcccactagaaaaaaacgaaaaagaagaaaaagaaaaagccccaccaaaacaagaaaat
tatatcagcattgaggattttaaaaaagtagagattaaagtggggcttatcaaagaagct
caaaggattgaaaaatccaataaattactgcgcttaaaagtggatttaggcgaaggttgt
ttgaggcagattgtctcagggatcgctttggattatgagcctgaaagcttggtgggtcaa
atggtgtgcgtggtggctaatttaaaacctgcaaagcttatgggtgaaatgagtgagggc
atgattttagcggtgcgagatagcgataatctagctttaatcagccctaccagagaaaaa
attgcaggaagtttgattagctaa

DBGET integrated database retrieval system