KEGG   Helicobacter pylori UM032: K747_07550Help
Entry
K747_07550        CDS       T02658                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyr  Helicobacter pylori UM032
Pathway
hpyr00071  Fatty acid degradation
hpyr00072  Synthesis and degradation of ketone bodies
hpyr00280  Valine, leucine and isoleucine degradation
hpyr00310  Lysine degradation
hpyr00362  Benzoate degradation
hpyr00380  Tryptophan metabolism
hpyr00620  Pyruvate metabolism
hpyr00630  Glyoxylate and dicarboxylate metabolism
hpyr00640  Propanoate metabolism
hpyr00650  Butanoate metabolism
hpyr00900  Terpenoid backbone biosynthesis
hpyr01100  Metabolic pathways
hpyr01110  Biosynthesis of secondary metabolites
hpyr01120  Microbial metabolism in diverse environments
hpyr01130  Biosynthesis of antibiotics
hpyr01200  Carbon metabolism
hpyr01212  Fatty acid metabolism
hpyr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpyr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    K747_07550
   00630 Glyoxylate and dicarboxylate metabolism
    K747_07550
   00640 Propanoate metabolism
    K747_07550
   00650 Butanoate metabolism
    K747_07550
  Lipid metabolism
   00071 Fatty acid degradation
    K747_07550
   00072 Synthesis and degradation of ketone bodies
    K747_07550
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K747_07550
   00310 Lysine degradation
    K747_07550
   00380 Tryptophan metabolism
    K747_07550
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K747_07550
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K747_07550
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    K747_07550
Enzymes [BR:hpyr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K747_07550
Exosome [BR:hpyr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K747_07550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGL67288
Position
1478428..1479603
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALNASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDVFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGVSIIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSIVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtggggagttttttaggctct
ctaaagagcgtgggtgctagagaaatgggtgctgtcgtgcttaaagacgctttgaatgcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaattagacgctggcatcccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaatatgagtgca
gcgccttatttgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattatgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgttttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaatttcaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgtgagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaaccatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagctttcgccgcg
caaagcatagccgtattaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggtgcgatagccattggccaccctattggtgcgagcggcgctaggattttagtgacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggctgcgcgtcattgtgtgtgggcggc
ggacaagggctatcaatagtagtggaacaaaaataa

DBGET integrated database retrieval system