KEGG   Helicobacter pylori UM032: K747_10065Help
Entry
K747_10065        CDS       T02658                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpyr  Helicobacter pylori UM032
Pathway
hpyr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpyr01100  Metabolic pathways
hpyr01110  Biosynthesis of secondary metabolites
hpyr01130  Biosynthesis of antibiotics
hpyr01230  Biosynthesis of amino acids
Module
hpyr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpyr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    K747_10065
Enzymes [BR:hpyr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     K747_10065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AGS15362
Position
complement(282514..283071)
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLSLKESMLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLGKLLE
ENTRTECVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKPDYTHLKDLGVLGVLEKVPHSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttatccttaaaagagagcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaattaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacacccgcaccgaatgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggcagaattc
gcttggcgtttgggcttaagcgtgtttgtagaaacccacaagccagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaaaaccaaaaaaaa
atagtttttttagattga

DBGET integrated database retrieval system