KEGG   Helicobacter pylori UM032: K747_11140Help
Entry
K747_11140        CDS       T02658                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hpyr  Helicobacter pylori UM032
Pathway
hpyr00540  Lipopolysaccharide biosynthesis
hpyr01100  Metabolic pathways
Module
hpyr_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hpyr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    K747_11140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyr01005]
    K747_11140
Enzymes [BR:hpyr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     K747_11140
Lipopolysaccharide biosynthesis proteins [BR:hpyr01005]
 Unusual sugar
  K747_11140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR
Motif
Other DBs
NCBI-ProteinID: AGL65908
Structure
PDB: 

Position
complement(65861..66853)
Genome map
AA seq 330 aa AA seqDB search
MRYIDDELENQTILITGGAGFVGSNLAFYFQENHPKAKVVVLDKFRSNTLFNNNRPSSLG
HFKNLIGFKGEVVIADINNPLDLRRLEKLHFDYLFHQAAVSDTTMLDQELVMKTNYQAFL
NLLEIARQKKAKVIYASSAGVYGNTKTPNVVGSNESPENVYGFSKLCMDEFVLSHSNDNI
QVGLRYFNVYGPREFYKEKTASMVLQLALGIMAFKEVKLFEFGEQLRDFVYIEDVIQANV
KAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFKVTYIKNPYAFFQNHTQAHIEPTIL
DLDYTPLYDLESGIKDYLPHIHAIFKEQHA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattgatgatgaattagaaaatcaaacgattttaatcaccggtggggccggc
tttgtgggcagtaatctggccttttattttcaagagaatcaccctaaagctaaagtggtg
gttttggataagtttcgcagtaacactctcttcaataataaccgccccagttccttaggg
cattttaagaatttaatcggttttaagggtgaggtggttatcgctgatattaataacccc
ttagatttaaggcgtttagaaaaattgcattttgattatttgttccaccaagccgctgtc
tctgatacgaccatgctggatcaagaattagtgatgaaaaccaactaccaggctttttta
aaccttttagaaatcgctcgccaaaaaaaagctaaagtgatttacgcttcttcagcgggc
gtttatggcaacaccaaaacccccaatgtggtaggctcaaacgaaagccctgaaaatgtt
tatggcttttccaagctttgcatggacgaatttgtcctctctcattcaaatgacaatatt
caagtgggcttaaggtattttaatgtctatgggcctagggagttttataaagaaaaaacc
gcttctatggttttgcaactcgccttaggcataatggcgtttaaggaagtcaagcttttt
gaatttggcgagcaattaagggattttgtctatattgaagatgtgatccaagcgaacgtg
aaagcgatgaaggctcaaaaaagcggggtttataatgtgggttattcccaagccagaagt
tataatgaaatagttagcattttaaaagagcatttaggggattttaaagtaacttatatc
aaaaacccttatgctttcttccaaaatcacacccaagcgcatattgaacccactattttg
gatttggattacacccctttatacgatttagaaagcggtattaaagattatttgccccat
atccatgcgatttttaaagaacagcatgcatga

DBGET integrated database retrieval system