KEGG   Helicobacter pylori SouthAfrica20: HPSA20_0721Help
Entry
HPSA20_0721       CDS       T02807                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpys  Helicobacter pylori SouthAfrica20
Pathway
hpys00071  Fatty acid degradation
hpys00072  Synthesis and degradation of ketone bodies
hpys00280  Valine, leucine and isoleucine degradation
hpys00310  Lysine degradation
hpys00362  Benzoate degradation
hpys00380  Tryptophan metabolism
hpys00620  Pyruvate metabolism
hpys00630  Glyoxylate and dicarboxylate metabolism
hpys00640  Propanoate metabolism
hpys00650  Butanoate metabolism
hpys00900  Terpenoid backbone biosynthesis
hpys01100  Metabolic pathways
hpys01110  Biosynthesis of secondary metabolites
hpys01120  Microbial metabolism in diverse environments
hpys01130  Biosynthesis of antibiotics
hpys01200  Carbon metabolism
hpys01212  Fatty acid metabolism
hpys02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPSA20_0721
   00630 Glyoxylate and dicarboxylate metabolism
    HPSA20_0721
   00640 Propanoate metabolism
    HPSA20_0721
   00650 Butanoate metabolism
    HPSA20_0721
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPSA20_0721
   00072 Synthesis and degradation of ketone bodies
    HPSA20_0721
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPSA20_0721
   00310 Lysine degradation
    HPSA20_0721
   00380 Tryptophan metabolism
    HPSA20_0721
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSA20_0721
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPSA20_0721
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPSA20_0721
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpys04147]
    HPSA20_0721
Enzymes [BR:hpys01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPSA20_0721
Exosome [BR:hpys04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPSA20_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGT73958
UniProt: T1UC07
Position
676657..677832
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKNVSTRQMGVSVLKDALKASGLEPNDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDRHAFSVNMVCGSSLKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNIAKAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFQKDGSV
TAGNSSGINDGASVVVLCSAKKAQELGLKVMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNTNDIHLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRNGHGVGCASLCVGGGQGISVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtagcggcaaagcgtagtgctgtggggagttttttaggctct
ttgaaaaatgtgagcactaggcaaatgggcgttagcgtgcttaaagacgctttgaaggcg
agcggacttgagccaaatgatgtagattctgtcattttaggcaatgttttaggcgctggt
ttgggtcaaaatatcgccagacagatccaactagacgctggcatccctaatgatcggcat
gcttttagcgttaatatggtttgcggatcgtccttgaaagccattcagttagcgcatgat
agcatcatgcttgggcgcgatgaagtggtggtgtgcggtggcgtagaaaacatgagtgca
gcgccttatttgtcgtttgacatgcgagaagggaagaggatggggaatgcaaacatgata
gactccatgatacatgatgggctatgggatgcattcaatgattaccacatggggatcacc
gcagacaatatcgctaaagcataccacataagccgagaagaacaagacgcatttgcgctc
caatcgcaactcaaagcaagagccgctatcaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacctgctttccaaaaagacggatcggta
acagcaggaaattcatcagggatcaatgatggcgctagcgtagtggttttatgcagcgcc
aaaaaagcgcaagagttagggctaaaagtcatggccactatcaaggggtttggtttgggc
ggttgcagtccggatataatgggtatatgcccaagcatcgcaattaaaaacaaccttaaa
aatgtcaaaatgaacaccaacgacatccatctttttgaactcaatgaagcctttgccgct
caaagcatagccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatggc
ggcgcgatagcgattggccatcctattggagcgagcggtgctaggatattggttaccctt
ttgcatgaaatgaagcgaaatgggcatggcgtgggttgcgcgtcattgtgcgtgggtggc
gggcaaggaatatcagtggtagttgaacaaaaataa

DBGET integrated database retrieval system