KEGG   Helicobacter pylori UM066: K751_03935Help
Entry
K751_03935        CDS       T02660                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyu  Helicobacter pylori UM066
Pathway
hpyu00280  Valine, leucine and isoleucine degradation
hpyu00310  Lysine degradation
hpyu00362  Benzoate degradation
hpyu00380  Tryptophan metabolism
hpyu00620  Pyruvate metabolism
hpyu00630  Glyoxylate and dicarboxylate metabolism
hpyu00640  Propanoate metabolism
hpyu00650  Butanoate metabolism
hpyu00900  Terpenoid backbone biosynthesis
hpyu01100  Metabolic pathways
hpyu01110  Biosynthesis of secondary metabolites
hpyu01120  Microbial metabolism in diverse environments
hpyu01130  Biosynthesis of antibiotics
hpyu01200  Carbon metabolism
hpyu01212  Fatty acid metabolism
hpyu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpyu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K751_03935
   00630 Glyoxylate and dicarboxylate metabolism
    K751_03935
   00640 Propanoate metabolism
    K751_03935
   00650 Butanoate metabolism
    K751_03935
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K751_03935
   00072 Synthesis and degradation of ketone bodies
    K751_03935
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K751_03935
   00310 Lysine degradation
    K751_03935
   00380 Tryptophan metabolism
    K751_03935
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K751_03935
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K751_03935
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    K751_03935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpyu04147]
    K751_03935
Enzymes [BR:hpyu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K751_03935
Exosome [BR:hpyu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K751_03935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGL71360
UniProt: R4QKR7
Position
837680..838855
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGTVVLKDALKASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGHDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARSAINAGKFQEEITPIEIANKKSVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASVIILCSAQKAQKLGLKAMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNSNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGYGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtggtggcggcaaaacgaagtgctgtggggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggcactgtcgtgcttaaagacgctctgaaagcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttaggcgccggt
ttgggtcaaaatatcgccagacagatccaattagatgctggcatcccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcacgatgaggtggtggtgtgcggtggcgtggaaaacatgagcgca
gcgccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgccaacatgata
gactccatgattcatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagatccgccattaatgcagggaaattccaagaagaaatcaca
cccattgaaatagcgaataaaaaaagcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtgttatcattttatgcagtgct
caaaaagcgcaaaaattggggttaaaagcaatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatcttaatgacatcaatctttttgaactcaatgaagctttcgccgca
caaagcatagccgtgttaaaagagcttgaattaaactctaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcaagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcggttatggcgtgggttgcgcgtcattgtgtgtgggcggc
ggacaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system