KEGG   Helicobacter pylori UM066: K751_07205Help
Entry
K751_07205        CDS       T02660                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hpyu  Helicobacter pylori UM066
Pathway
hpyu00020  Citrate cycle (TCA cycle)
hpyu00620  Pyruvate metabolism
hpyu01100  Metabolic pathways
hpyu01110  Biosynthesis of secondary metabolites
hpyu01120  Microbial metabolism in diverse environments
hpyu01130  Biosynthesis of antibiotics
hpyu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpyu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    K751_07205
   00620 Pyruvate metabolism
    K751_07205
Enzymes [BR:hpyu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     K751_07205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Pyr_redox Lycopene_cycl Thi4 PEX-1N FAD_binding_2 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGL71987
UniProt: R4QPS7
Position
126130..127482
Genome map
AA seq 450 aa AA seqDB search
MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSI
ETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEECEFMKKRYESFKE
IFVGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYQKDWSTMNFAKLSENFVEEALK
LKPNNQVFLNFKVKKIEKRNDTYALISEDAEEVYAKFVLVNAGSYALPLAQSMGYGLDLG
CLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALTMPKLERNK
CWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVFKNMVFELPVIGKRKFLKDAQKII
PSLSLEDLEYAHGFGEVRPQVLDRTKQKLELGEKKICTHKGITFNMTPSPGATSCLQNAL
VDSQEIAAYLDESFELERFYRDLSPEELEN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaatttgatgctgttattattggaggtggggtttcagggtgcgcgaccttt
tatactttgagcgagtacagctctttaaagcgcgtggctatcgtggaaaaatgctctaaa
ttggctcaaatcagctccagcgctaaagctaattcgcaaaccattcatgatggctctatt
gaaacgaattacactcccgaaaaagctaaaaaagtgcgtttgagcgcttataagaccagg
caatacgcgctcaataaaggcttgcaaaatgaagtgatttttgaaacccaaaaaatggct
ataggcgtgggcgatgaagaatgcgagttcatgaaaaaacgctacgaatcctttaaagaa
atctttgtggggttagaagaatttgacaaacaaaagattaaagaattagagcctaatgtg
attttaggggctaatggcatagataggcatgaaaacattatcgggcatggttatcaaaaa
gattggagcaccatgaattttgcgaagttgagcgaaaacttcgttgaagaagccctaaaa
ttaaagcctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaac
gacacttacgcgctcatttcagaagacgctgaagaagtgtatgctaaattcgtgctagtc
aatgccggctcttacgctttgcctttggctcagagcatgggttatggcttggatttaggg
tgcttgcctgtggcgggtagcttttattttgtgccggatttattaaggggtaaggtttat
accgttcaaaaccccaaactcccttttgcagccgtgcatggcgaccctgatgccgtcatt
aaaggaaaaacacgaatcgggcctaccgctttaacgatgcctaaattagaacgcaacaaa
tgttggcttaagggcattagcttggaattgttgaaaatggatttgaataaagatgtgttt
aaaattgcgtttgatttgatgagcgataaagaaatccgtaattatgtgtttaaaaacatg
gtttttgaattgcccgttatcggtaaaaggaagtttttaaaagacgctcaaaaaatcatc
ccctctcttagcctagaagatttagaatacgctcatggttttggcgaagtgcgcccgcaa
gttttagacagaaccaagcaaaagttagaattaggcgaaaaaaagatttgcacccataaa
ggcatcacttttaacatgaccccttctccaggcgcgacaagttgcttgcaaaacgccctt
gtggattctcaagaaatcgctgcgtatttggacgagagctttgaattagaacgcttttat
agagatttatccccagaagaattggaaaattaa

DBGET integrated database retrieval system