KEGG   Helicobacter pylori 52: HPKB_0287Help
Entry
HPKB_0287         CDS       T01898                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpz  Helicobacter pylori 52
Pathway
hpz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpz01100  Metabolic pathways
hpz01110  Biosynthesis of secondary metabolites
hpz01130  Biosynthesis of antibiotics
hpz01230  Biosynthesis of amino acids
Module
hpz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPKB_0287
Enzymes [BR:hpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPKB_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACX98897
UniProt: D0JYH7
Position
289751..290308
Genome map
AA seq 185 aa AA seqDB search
MQEIRILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLGKLLE
ENTRTECVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFAWRLGLSVFVETHKKDYTHLKDLGVLGVLEKVPHSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaataaggattttagaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgctaggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaattaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacacccgcacagaatgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttggggttattgcgccgccatgcgagctctttgatt
gtccatcaggatcttttcatcagccattaccagctcttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggaatggtagaattc
gcttggcgtttgggcttaagcgtgtttgtagaaacccacaaaaaagactacacccattta
aaagatttaggagttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaaa
atagtttttttagattga

DBGET integrated database retrieval system