KEGG   Helicobacter pylori 52: HPKB_0317Help
Entry
HPKB_0317         CDS       T01898                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
hpz  Helicobacter pylori 52
Pathway
hpz00860  Porphyrin and chlorophyll metabolism
hpz01100  Metabolic pathways
hpz01110  Biosynthesis of secondary metabolites
hpz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPKB_0317
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpz01007]
    HPKB_0317
Enzymes [BR:hpz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     HPKB_0317
Amino acid related enzymes [BR:hpz01007]
 Aminotransferase (transaminase)
  Class III
   HPKB_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ACX98927
UniProt: D0JYK7
Position
329054..330346
Genome map
AA seq 430 aa AA seqDB search
MELLHSINDFNEAKHVIAGGVNSPVRAFKSVKGTPPFILKGKGAYLYDVDNNHYIDFVQS
WGPLIFGHADEEIEENIINVLKKGTSFGAPTELETTLAKEIISCYEGLDKVRLVNSGTEA
TMSAIRLARAYSQKDDLIKFEGCYHGHSDSLLVKAGSGCATFGSPSSLGVPNDFSKHTLV
ARYNDLNSTEECFKKGDVGCVIIEPIAGNMGLVPAQKEFLLGLKALCEKYQAVLILDEVM
SGFRASLSGSQEFYGVVPDLVTFGKVIGAGLPLACFGGRAEIMDLLSPIGGVYQAGTLSG
NPLAVCAGLSTLYKIKRDKTLYTRLNALAVRLTQGLKKSAQSYNIALETLNRGSMFGFFF
NENAVHDFDDALKSDTEMFAKFHQKMLFKGVYLACSSFETGFICEPMTEEMIDLAVAKAD
ESFDEIIKGV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggagttgttgcacagcattaatgattttaatgaagctaagcatgtgatcgctgggggg
gtcaattcgcctgtgagggcgtttaagagcgttaaaggcactcccccctttattttaaag
ggtaagggggcgtatctttatgatgtggataacaaccattatatagattttgtgcaaagt
tgggggcctttgatttttgggcatgctgatgaagaaattgaagaaaatattattaatgta
ttaaaaaaaggcacttcttttggcgctcccacagaattagaaaccactttagctaaggag
atcatttcttgttatgaaggtttagataaggtgcgtttagtgaatagtggcacagaagcg
accatgagcgcgatacgactcgctagagcttatagccaaaaagacgatttgatcaagttt
gaagggtgctatcatgggcatagcgactccttattggtgaaagcgggtagcgggtgcgcg
acttttggatcgccttcttctttaggcgtgccgaacgattttagcaaacacactttagtg
gctcgttataacgatttaaattccacagaagaatgctttaaaaaaggcgatgtgggttgc
gtcatcattgaacccattgccgggaatatggggttggtgccggctcaaaaagagttttta
ttaggcttaaaggctttgtgtgaaaaataccaagcggtgctgattttagatgaagtgatg
agtgggtttagagcgagcttgagcggttctcaagaattttatggcgtggtgccggatttg
gtaacctttggtaaggtgataggtgcagggcttcctttggcgtgttttggggggcgtgcg
gaaattatggacttgctttcacccattggaggcgtgtatcaagcaggcacattgagcggt
aaccctttagcggtgtgtgcggggttgagcacgctttataaaatcaaaagagataaaacc
ctttatacccgcttaaacgctttagccgttcgtttgactcaaggtttaaaaaagagtgct
caaagctataacatcgctttagagactctcaatagagggagcatgtttggctttttcttt
aacgaaaatgcggtgcatgattttgatgacgctttaaaaagcgatacggaaatgtttgca
aaattccaccaaaaaatgctctttaagggcgtgtatttggcatgttcaagctttgaaact
ggctttatttgtgagcctatgactgaagagatgattgatttagcggttgcaaaagccgat
gaaagttttgatgaaatcataaaaggtgtgtga

DBGET integrated database retrieval system