KEGG   Helicobacter pylori 52: HPKB_0657Help
Entry
HPKB_0657         CDS       T01898                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpz  Helicobacter pylori 52
Pathway
hpz00071  Fatty acid degradation
hpz00072  Synthesis and degradation of ketone bodies
hpz00280  Valine, leucine and isoleucine degradation
hpz00310  Lysine degradation
hpz00362  Benzoate degradation
hpz00380  Tryptophan metabolism
hpz00620  Pyruvate metabolism
hpz00630  Glyoxylate and dicarboxylate metabolism
hpz00640  Propanoate metabolism
hpz00650  Butanoate metabolism
hpz00900  Terpenoid backbone biosynthesis
hpz01100  Metabolic pathways
hpz01110  Biosynthesis of secondary metabolites
hpz01120  Microbial metabolism in diverse environments
hpz01130  Biosynthesis of antibiotics
hpz01200  Carbon metabolism
hpz01212  Fatty acid metabolism
hpz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPKB_0657
   00630 Glyoxylate and dicarboxylate metabolism
    HPKB_0657
   00640 Propanoate metabolism
    HPKB_0657
   00650 Butanoate metabolism
    HPKB_0657
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPKB_0657
   00072 Synthesis and degradation of ketone bodies
    HPKB_0657
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPKB_0657
   00310 Lysine degradation
    HPKB_0657
   00380 Tryptophan metabolism
    HPKB_0657
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPKB_0657
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPKB_0657
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPKB_0657
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpz04147]
    HPKB_0657
Enzymes [BR:hpz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPKB_0657
Exosome [BR:hpz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPKB_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACX99251
UniProt: D0JZI1
Position
complement(677240..678415)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALKVSGLEPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGHDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDTFAL
QSQLKARVAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMAAIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgcagtggggagttttttaggctct
ctaaagagcgttggcgctagagaaatgggcgctgtcgtgcttaaagacgctctgaaggtg
agcggtcttgagcctagcgatgtggattctgtcattttaggcaatgttttatccgctggt
ttgggtcaaaatattgccaggcagatccaattagacgctggcatcccgaatgacaggaac
gcttttagcgttaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcacgatgaggtggtggtgtgcggtggcgtggaaaacatgagtgca
gcgccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgccaacatgata
gactccatgatccatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatacttttgcgctc
caatcgcaactcaaagcaagagttgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagatggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattattattttatgcagtgct
caaaaagcgcaaaaattggggttaaaaacaatggcagctatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagcctttgccgcg
caaagcatagccgtattaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcaagcggcgctaggattttggtaacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggctgtgcgtcattgtgtgtgggcggc
ggacaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system