KEGG   Helicobacter pylori 52: HPKB_1031Help
Entry
HPKB_1031         CDS       T01898                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
hpz  Helicobacter pylori 52
Pathway
hpz00030  Pentose phosphate pathway
hpz00480  Glutathione metabolism
hpz01100  Metabolic pathways
hpz01110  Biosynthesis of secondary metabolites
hpz01120  Microbial metabolism in diverse environments
hpz01130  Biosynthesis of antibiotics
hpz01200  Carbon metabolism
Module
hpz_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:hpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HPKB_1031
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HPKB_1031
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpz04147]
    HPKB_1031
Enzymes [BR:hpz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     HPKB_1031
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     HPKB_1031
Exosome [BR:hpz04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   HPKB_1031
  Exosomal proteins of colorectal cancer cells
   HPKB_1031
  Exosomal proteins of bladder cancer cells
   HPKB_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N HAUS2 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACX99597
UniProt: D0K0H7
Position
1093264..1094541
Genome map
AA seq 425 aa AA seqDB search
MLDFDLVLFGATGDLAMRKLFVSLYEIYTYYGFKKDSKIIASGRKELSNEEFLALLCEKT
QLHSREKGEEFLAHISYCCVRLDNPKDFEELSKIATKNKPLIFYFSISPSFFATTAQYLA
KNALNHANTRLILEKPLGHDLKTCKEIFQSISAFFKEEQIFRIDHYLGKKGVQNILELRL
NNPILNILWDQISAVEICVYETLGVEERGEFYDKIGALRDMVQNHLLQVLSLIATDLPND
LKDLRKEKIKVLKTLQPPKDFKKQVIRAQYQGYRDENKVNKESQIETFVAIKAFLDTPKF
KGVPFYLKHAKKMPRNQASAKIHFNAVNALEFFLSQDKITLTLQDHQNPLILETHHKQEF
LQPYAKLLYDAIQNNHNNFAHQLELEASWVFIDTLIEGFMNNATPLYSYESHNLNESEFL
KPLYQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgttagattttgatttggttctttttggcgcgactggggatttagccatgcgaaagctc
tttgtttcgctctatgaaatttatacctattatggttttaaaaaagattctaaaattatc
gcatctgggcgtaaggagctatccaatgaagaatttttagcgcttctttgcgaaaagaca
caactgcattcaagagaaaagggtgaggaatttttagcccatatcagttattgttgcgtt
cgtttggataaccctaaagactttgaagaattgagtaaaatcgctacaaaaaataaaccc
ttgattttctacttttccatctcccccagtttttttgcaacgaccgcccaatatctcgcc
aaaaacgcgctcaatcacgctaacacgcgcttgatcttagaaaagcctttagggcatgat
ttaaagacttgtaaggagattttccaaagcattagcgctttttttaaagaagagcaaatc
tttagaatcgatcattatttagggaaaaagggcgttcaaaatatccttgaattgcgctta
aataaccctatcttaaacattttatgggatcaaatcagcgcggttgaaatctgcgtgtat
gagactttgggggtggaagaaaggggcgaattttacgataaaatcggagctttaagggat
atggttcaaaaccatcttttgcaagttttatcccttatcgctacagatttacccaacgat
ttaaaggatttgaggaaagaaaaaatcaaagttttaaaaaccttacaacccccaaaagac
tttaaaaaacaggttattcgggcccaatatcaaggctatagagatgaaaataaggtcaat
aaagagagccagatagaaacttttgtcgctattaaagcctttttggatacgcctaaattt
aaaggcgtgcctttctaccttaaacacgctaaaaaaatgccccgcaaccaagcgagtgcg
aaaatccattttaatgcagtcaatgcactagaattttttctctctcaagataaaatcacc
ctcaccctacaagatcatcaaaacccccttattttagaaacccatcacaaacaagaattt
ttacagccctacgctaaattgctctatgatgcgatacaaaataaccacaataatttcgcc
caccagttggaattagaagcgtcatgggtttttattgacacgctcatagaaggttttatg
aataacgccacgcccttatattcctatgaaagccacaatttaaacgaatcagaattttta
aaaccactctatcaatga

DBGET integrated database retrieval system