KEGG   Herbaspirillum rubrisubalbicans: Hrubri_0820Help
Entry
Hrubri_0820       CDS       T04238                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00010  Glycolysis / Gluconeogenesis
hrb00053  Ascorbate and aldarate metabolism
hrb00071  Fatty acid degradation
hrb00280  Valine, leucine and isoleucine degradation
hrb00310  Lysine degradation
hrb00330  Arginine and proline metabolism
hrb00340  Histidine metabolism
hrb00380  Tryptophan metabolism
hrb00410  beta-Alanine metabolism
hrb00561  Glycerolipid metabolism
hrb00620  Pyruvate metabolism
hrb00625  Chloroalkane and chloroalkene degradation
hrb00903  Limonene and pinene degradation
hrb01100  Metabolic pathways
hrb01110  Biosynthesis of secondary metabolites
hrb01120  Microbial metabolism in diverse environments
hrb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hrubri_0820
   00053 Ascorbate and aldarate metabolism
    Hrubri_0820
   00620 Pyruvate metabolism
    Hrubri_0820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hrubri_0820
   00561 Glycerolipid metabolism
    Hrubri_0820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hrubri_0820
   00310 Lysine degradation
    Hrubri_0820
   00330 Arginine and proline metabolism
    Hrubri_0820
   00340 Histidine metabolism
    Hrubri_0820
   00380 Tryptophan metabolism
    Hrubri_0820
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hrubri_0820
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Hrubri_0820
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hrubri_0820
Enzymes [BR:hrb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Hrubri_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 LuxC BMC
Motif
Other DBs
NCBI-ProteinID: ALU88037
UniProt: A0A0U3BDN7
Position
complement(937372..939747)
Genome map
AA seq 791 aa AA seqDB search
MSVSTYFDTMDYGPAPESDKDARAWLASHEASFGHFIGGRFTRPGAQLEDVDPASGKLLA
HLTQGSPADVEAAVNAAQAALPDWQALGGHGRARHLYALARSVQRHARLLAVLETLDNGK
PLRESRDIDVPLVARHFYHYAGWAQLQEREFPDHVPLGVVGQIVPWNFPLLMLAWKIAPA
LALGNTVVLKPAETTSLSALLFAELAQQAGLPAGVLNIVTGDGATGAAVVAHPGIQKIAF
TGSTEVGRLIRQQTAGSGKSLTLELGGKSPFIVFEDADIDAAIEGVVDAIWFNQGQVCCA
GSRLLVQEGIHDLFIARLKTRMEKLKVGAPLDKCSDMGALISAEQLQRVKRLVEQGVREG
AQCHQVALQTDPAGCFYPPTLLTSVHPACTVATEEIFGPVLVAMSFRTPDEAVQLANNSR
YGLAASIWSETIGLALGVAPQLKAGVVWINSTNQFDAAVGFGGYRESGYGREGGREGCYE
YLKPRHRLGRALRQAVAPRAARQDGPLQTSHIDRTAKLYIGGKQVRPDGEVSMACFGAQG
ERLEDVGLGNRKDIRNAVAAAVKAGGWSSATGHRRAQALYYIAENLSARSAEFARRISAT
SGVSPEEANAEVDAAIRRLFSYGAWADKFEGAVHQPPMRGVALAMPEAIGVIGVVCPEEK
PLLSFISLVAPAIAMGNRVVVVPSQQAALVATDLYQVLDTSDLPAGVINIVTGKSAELLT
VLAEHDEVDALWVRGPAEFSATAERLSIGNLKRCFVDYGQVTDWHDIEQGEGSEYLRQAT
QIKNIWIPYGE
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttccacctacttcgacaccatggattacggccccgcccccgagagtgacaag
gatgcccgcgcctggctggccagccacgaagcttcgttcggccacttcatcggcggccgc
ttcacccggcccggcgcccaactggaagacgttgatccggccagcggcaagctgctggcc
catctgacacaaggttcgccagccgatgtcgaggcggccgtcaacgcggcccaggccgcc
ctgcccgactggcaggcgctgggcggccatggccgcgcacgccatctgtatgcactggcg
cgcagcgtacagcgtcatgcgcgcttgctggcagtgctggagaccctggacaacggcaag
ccgctgcgcgaatcgcgcgacatcgacgtgccgctggtggcgcgccacttctatcactac
gccggctgggcgcaattgcaggagcgcgagttccccgaccatgtgccgctgggcgtggtc
ggtcagatcgtgccgtggaatttcccgctgctgatgctggcctggaagatcgcccccgcc
ctggcgctgggcaatacggtggtgctcaagccggccgaaacgacgtcgttaagcgccctg
ctgtttgccgaactggcccagcaggctggcctgccggccggggtactcaatatcgtcacc
ggcgatggcgccaccggcgcggccgtggtggcgcatccgggcatccagaagatcgccttt
accggctccaccgaagtaggtcgcctgatccgccaacagaccgccggcagcggcaagtcg
ctgaccctggaactgggtggcaagtcgcccttcatcgtgttcgaggatgccgacatcgac
gccgccatcgaaggcgtggtcgatgccatctggttcaaccagggccaggtgtgctgtgcc
ggcagtcggctgctggtgcaggaaggcatccatgatctgttcatcgcgcgcctcaagacg
cgcatggaaaaactcaaggtcggcgcgcccctggacaagtgcagcgacatgggcgcactg
atctctgccgagcaactgcaacgcgtcaagcgcctggtcgaacagggggtgcgcgagggg
gcgcaatgtcatcaggtggcgctgcaaaccgatccggccggctgcttctatccccctacg
ctcttgaccagcgtacatccggcctgcaccgtggccaccgaggaaatcttcggtccggtg
ctggtggcgatgagtttccgcacccccgacgaagcggtacaactggccaacaacagccgc
tacggcctggccgccagcatctggagcgagaccatcggcctggccctgggcgtggccccg
caactcaaagcaggcgtggtctggatcaacagcaccaaccagttcgatgcagcggtgggc
tttggcggctatcgcgaatcgggctatgggcgcgaaggtgggcgcgagggctgctacgaa
tacctgaagccgcgtcaccgcctgggccgcgccttgcgtcaggccgtagcaccacgagcg
gcacgccaggatgggccgctgcaaaccagccacatcgaccgcaccgccaagctctacatc
ggcggcaagcaagtacggcccgatggcgaagtctccatggcctgcttcggtgcccagggc
gagcggctggaggatgtggggctgggcaatcgcaaggatatccgcaatgccgtggccgct
gccgtcaaggccggtggctggagcagcgccaccgggcatcgccgggcgcaagctctgtac
tacatcgccgagaatctatcggcgcgctccgcggaattcgcccgccgcatcagcgccacc
agcggcgtgtcgccagaagaggcaaacgccgaagtggacgctgcgatccgtcgcttgttc
tcctatggcgcctgggccgacaagttcgaaggcgccgtgcaccagccccccatgcgcggc
gtggcgctggccatgccggaagccatcggggtcatcggcgtggtctgccccgaggaaaag
ccgctgctgtccttcatcagcctggtggcgcccgccattgccatgggcaaccgggtggtg
gtggtgcccagccagcaggccgcgctggtggcgaccgatctctatcaggtgctggatacc
tctgacctgcctgccggggtcatcaacatcgtcactggcaagagtgccgaactgctcacg
gtgctggccgaacatgatgaagtcgatgccctgtgggtgcgtggcccggcagagttctcg
gccaccgccgagcgcttgtccatcggcaatctcaagcgctgcttcgtcgactatggccag
gtcaccgactggcatgacatcgaacagggcgaaggcagcgaatacctgcggcaggcaacg
cagatcaagaacatctggattccttacggcgaataa

DBGET integrated database retrieval system