KEGG   Herbaspirillum rubrisubalbicans: Hrubri_0908Help
Entry
Hrubri_0908       CDS       T04238                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase protein
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00030  Pentose phosphate pathway
hrb00480  Glutathione metabolism
hrb01100  Metabolic pathways
hrb01110  Biosynthesis of secondary metabolites
hrb01120  Microbial metabolism in diverse environments
hrb01130  Biosynthesis of antibiotics
hrb01200  Carbon metabolism
Module
hrb_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hrubri_0908 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Hrubri_0908 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hrb04147]
    Hrubri_0908 (zwf)
Enzymes [BR:hrb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Hrubri_0908 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Hrubri_0908 (zwf)
Exosome [BR:hrb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Hrubri_0908 (zwf)
  Exosomal proteins of colorectal cancer cells
   Hrubri_0908 (zwf)
  Exosomal proteins of bladder cancer cells
   Hrubri_0908 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ALU88124
UniProt: A0A0U3KVP2
Position
complement(1066608..1068074)
Genome map
AA seq 488 aa AA seqDB search
MATSDFDLVLFGGTGDLSMRKLLPALYARDRGRDLPPNARIICLGREEKSREDFLKLVEK
DSKPHVPPSNLDAAVWERFTNRLQYASVNAKDAASFAHLKEALRDIDGLARVFYLATPPS
LFASICENLSKAGLVTPSARVVLEKPLGRDLESARDINAQVGRFFQESQIFRIDHYLGKE
AVQNLLALRFGNVLFEPLWRREWISDVQITIAEELGVGGRFDYYDTSGALRDMLQNHLLQ
LLCIVAMEPPVSNSADAVRDEKLKVLRSLKRFTPTTLAMNVVRGQYRAGHVDGVAVPAYR
KEADANPDSRTETYVAVKAEIDTWRWAGVPFYLRTGKRMADSLAEIVVRFKSVPHSIFAH
QNDTPNCLVIRLQPDEGLHMNLMAKQPGDGMRLRPVELELDFREKFKTPRMDAYERLLLD
VLRGHLTLFMRSDELEAAWEWVEPILNYWDQQEADPVPYNAGTWGPAAASALIGRDGLQW
REEALPEV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctacttctgatttcgatctggttttattcggcggcaccggcgacctctccatgcgc
aagctgctgccggcgctctacgcgcgtgaccgtggtcgcgacctgccccccaatgcacgc
atcatctgcctgggccgcgaagaaaaatcacgcgaggacttcctgaagctggtggaaaag
gattccaaaccccacgtccccccctccaacctggacgctgccgtctgggaacgcttcacc
aaccgcctgcaatacgcctcggtcaatgccaaggacgccgccagcttcgctcatctgaag
gaagccctgcgcgatatcgacggcctggcccgcgtgttctacctggccacgccgcccagc
ctgtttgcctcgatctgcgagaacctctccaaggccggactggtcactccgagcgcgcgc
gtggtgctggaaaaaccgctgggccgcgacctggaaagcgcgcgcgacatcaatgcgcaa
gtgggtcgcttcttccaggaatcgcagatcttccgtatcgaccactatctgggcaaagaa
gcggtgcagaacctgctggcgctgcgctttggcaatgtgctgttcgaaccgctgtggcgg
cgtgaatggatttccgatgtgcagatcaccatcgccgaagaactcggcgtaggtggccgc
ttcgactactacgacacctccggcgcgctgcgcgacatgctgcagaaccacctgctgcaa
ctgctgtgtatcgtcgccatggaaccgcccgtctccaattcggctgacgccgtgcgggac
gaaaaactgaaggtgctgcgctcactgaaacgcttcaccccgaccacactggccatgaac
gtggtgcgcggccaatatcgcgccggtcacgtcgatggcgtggccgtgcccgcctatcgc
aaggaagccgacgccaatcccgattcgcgcaccgaaacctacgtcgcggtcaaggccgag
atcgatacctggcgctgggccggcgtgcccttctacctgcgcaccggcaagcgcatggcc
gattcgctggccgagatcgtggtgcgcttcaagagcgtgccgcactccatcttcgcgcac
cagaacgacacccccaactgcctggtgatccgcctgcagcccgatgaagggctgcacatg
aacctgatggccaagcagccgggcgacggaatgcgcctgcgtccggtcgagctggaactg
gacttccgcgagaagttcaagaccccgcgcatggatgcctacgagcgcctgctgctggac
gtgctgcgtggtcacctgaccctgttcatgcgcagcgacgaactggaagccgcctgggaa
tgggtggagccgatcctcaattattgggaccagcaggaagctgacccggtgccctacaac
gccggcacctggggaccggctgcggccagtgccctgatcggtcgcgacggcctgcagtgg
cgtgaagaagccttgccagaggtctga

DBGET integrated database retrieval system