KEGG   Herbaspirillum rubrisubalbicans: Hrubri_1388Help
Entry
Hrubri_1388       CDS       T04238                                 

Gene name
murI
Definition
(GenBank) glutamate racemase protein
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00471  D-Glutamine and D-glutamate metabolism
hrb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Hrubri_1388 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hrb01011]
    Hrubri_1388 (murI)
Enzymes [BR:hrb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Hrubri_1388 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:hrb01011]
 Precursor biosynthesis
  Racemase
   Hrubri_1388 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ALU88598
UniProt: A0A0U3K779
Position
complement(1635508..1636401)
Genome map
AA seq 297 aa AA seqDB search
MKEAVKQALTPSAVNLERTTPMPTAADAAVGIFDSGVGGLSVLQHIHAALPREQLLYFAD
AGYAPYGEKTDEQIVERSLTIASFLIDQRIKALVVACNTATAAAIQAIRVHWPQLPVVGI
EPGLKPAAQQTRCAIVGVLATRSTLASKRFALLQAQMEAQYRVRYLPQACVGLVDLIEKG
ELYSPATVQLLERYLTPLLEQGADTLVLGCTHYPFVRPAIESVCQRLVGAVPDIIDTGQA
VTRQLQRLLETDALLTQAATGSLAGFTTSSRSTLEQAFRGLLKLDPPVQALQPQAGA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagccgtcaagcaagccctcacaccttctgccgtgaacctggagcgcaccacc
ccgatgccgaccgcagccgatgccgcggtcggcattttcgattccggcgttggtggcctg
tcggtgctgcaacacatccatgccgccctgccccgcgaacaactgctctacttcgccgac
gccggctatgcgccctatggcgagaagaccgatgaacagatcgtggagcgctcgctgacc
atcgcctccttcctgatcgaccagcggatcaaggccctggtggtggcctgcaataccgcc
accgccgcagccatccaggccatccgggtgcactggccgcaactgccggtggtgggtatc
gagccgggcctcaaacccgctgcccagcaaacccgctgcgctatcgtaggcgtgctggcc
acccgcagcacgctggccagcaagcgctttgccttgctgcaggcgcaaatggaggcgcaa
taccgggtccgttatctaccgcaagcctgcgtgggactggtggacttgatcgagaaaggc
gaactgtattcgccggccacggtgcaattgttggagcgctacctgacgccgctgctggaa
caaggggccgatacgctggtactgggctgcacccactatccgttcgtgcgcccagctatc
gaaagcgtttgccagcgcctggtgggggcagtgccagacatcatcgatactggacaagcc
gtgacgcggcaattgcagcgcctgcttgaaaccgatgccctgctgacccaggccgccacc
ggctcgctggcgggcttcacgaccagcagccggtctacgctggaacaggctttccgaggt
ttgctcaagctcgatcccccggtacaggccttgcagccgcaagcaggggcatga

DBGET integrated database retrieval system