KEGG   Herbaspirillum rubrisubalbicans: Hrubri_1837Help
Entry
Hrubri_1837       CDS       T04238                                 

Gene name
gpmB
Definition
(GenBank) phosphoglycerate mutase 2 protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00860  Porphyrin and chlorophyll metabolism
hrb01100  Metabolic pathways
Module
hrb_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hrubri_1837 (gpmB)
Enzymes [BR:hrb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Hrubri_1837 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ALU89035
UniProt: A0A0U3L0V0
Position
2124790..2125407
Genome map
AA seq 205 aa AA seqDB search
MQLYLIRHPQPLLDKHTCYGRSDIAVAPAMLAQCVTQLLPALQALPPGLAMVSSPLRRCA
DLAQALAEQLSWPAPALEPRLQEMDFGNWELRPWDDIPWAEVEAWNADLLHHAPGGGETL
LAVAQRMWQAFASLLAQPAPGAIVICHAGSIRMLQACAAWRAEQGSAPASTPQIFDDIAL
RAVAQRQEIPYAQVLPLDLSMAQQR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctacctgatccgccatccgcagccgctgctggacaagcacacctgctatggc
cgcagcgacatcgccgtggcgcccgccatgctggcgcagtgcgtaacgcaattgctgccc
gcactgcaagctttgccgcccggcctggcgatggtcagcagcccgctgcggcgctgcgcc
gatctggcccaggccctggccgagcaattgtcgtggccggcgcccgcgctggaaccgcgc
ttgcaggaaatggatttcggcaactgggaattgcgcccctgggatgacatcccttgggcc
gaggtcgaagcttggaatgccgacctgctgcaccatgcgccgggtggcggcgagaccctg
ctggcggtggcgcagcgcatgtggcaggcgtttgccagcctgctcgcccagccggcgccc
ggcgccatcgtgatctgtcatgccggctcgatccgcatgttgcaggcttgtgcggcatgg
cgcgcagagcaggggagcgcgcctgcctctactcctcagatatttgacgacatcgccttg
cgcgccgtcgcccagcgccaggagattccctacgcccaggtgctgccgctggacctctcc
atggcccagcagcgttaa

DBGET integrated database retrieval system