KEGG   Herbaspirillum rubrisubalbicans: Hrubri_1962Help
Entry
Hrubri_1962       CDS       T04238                                 

Gene name
pitA
Definition
(GenBank) low-affinity phosphate transporter lipoprotein transmembrane protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hrb  Herbaspirillum rubrisubalbicans
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Hrubri_1962 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ALU89154
UniProt: A0A0U3LEM1
Position
2247501..2248508
Genome map
AA seq 335 aa AA seqDB search
MQTIQISLHILALLIVLALLFDFMNGFHDAANAIATVVSTGVLRPQTAVAMAAFFNLAAV
FVFHQLHVAASVGKGTIDPAIVDQYVIFGALIGAIFWNLVTWYYGIPSSSSHALIGGLVG
SAVAKAGTGALISAGLLKTILFIVLSPLLGLVFGSLMMLAVSWIFYRSTPRKIDGWFRRL
QLLSASMYSLGHGGNDAQKTIGIIWMLLIASGYSSPEAPPMWVIICCYCAISLGTLFGGW
RIVKTMGQKITKLKPVGGFCAETGGAITLFIATALGIPVSTTHTITGAIVGVGAAQKMSA
VRWGVASNIVWAWIFTIPASAFVAAIAWWVGVHVL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaatccaaatcagcttacatatcctcgcgttgttgatcgtcctggcactgctg
ttcgacttcatgaatggcttccacgatgccgccaacgcgattgccaccgtggtttccacc
ggtgtgctgcgcccgcagaccgcggtggctatggccgccttcttcaacctggcggcggtg
ttcgtgttccaccagctgcacgtcgcagcctcggtaggcaagggtaccatcgatcccgcc
atcgtcgaccagtacgtgatcttcggggccttgatcggcgccatcttctggaacctggtg
acctggtattacggcattccgtcttcttcctcgcacgccctcatcggcggcctggtcggt
tcggccgtagccaaggctggcaccggcgcgctgatctcggcaggtctgttgaagacgatt
ctcttcatcgtgctttctcccttgctgggcctggtgttcggttcgctgatgatgctcgcc
gtatcgtggatcttctatcgctccacgccccgcaagatcgacggctggttccggcgcctg
caattgctgtcggcttccatgtatagcctgggccacggcggcaacgatgcgcaaaagact
atcggcatcatctggatgctgctgatcgcttccggctattcctcgccggaagcgccgccc
atgtgggtcatcatctgctgctactgcgccatcagcctgggcacgctctttggcggctgg
cgcatcgtcaagaccatggggcaaaagatcaccaagttgaagcctgtcggtggtttctgt
gccgaaaccggtggtgcgatcaccttgttcatcgccactgcattgggtattccggtctcg
accacgcacaccatcaccggtgccatcgtcggcgtgggtgcggcgcagaagatgtcggcg
gtgcgctggggcgtggccagcaacatcgtctgggcctggatcttcaccatcccggcgtcg
gccttcgtggcggccattgcctggtgggtcggggtgcacgtgctgtaa

DBGET integrated database retrieval system