KEGG   Herbaspirillum rubrisubalbicans: Hrubri_3962Help
Entry
Hrubri_3962       CDS       T04238                                 

Gene name
paaJ
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00071  Fatty acid degradation
hrb00072  Synthesis and degradation of ketone bodies
hrb00280  Valine, leucine and isoleucine degradation
hrb00310  Lysine degradation
hrb00362  Benzoate degradation
hrb00380  Tryptophan metabolism
hrb00620  Pyruvate metabolism
hrb00630  Glyoxylate and dicarboxylate metabolism
hrb00640  Propanoate metabolism
hrb00650  Butanoate metabolism
hrb00900  Terpenoid backbone biosynthesis
hrb01100  Metabolic pathways
hrb01110  Biosynthesis of secondary metabolites
hrb01120  Microbial metabolism in diverse environments
hrb01130  Biosynthesis of antibiotics
hrb01200  Carbon metabolism
hrb01212  Fatty acid metabolism
hrb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hrubri_3962 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    Hrubri_3962 (paaJ)
   00640 Propanoate metabolism
    Hrubri_3962 (paaJ)
   00650 Butanoate metabolism
    Hrubri_3962 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hrubri_3962 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    Hrubri_3962 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hrubri_3962 (paaJ)
   00310 Lysine degradation
    Hrubri_3962 (paaJ)
   00380 Tryptophan metabolism
    Hrubri_3962 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hrubri_3962 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hrubri_3962 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Hrubri_3962 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hrb04147]
    Hrubri_3962 (paaJ)
Enzymes [BR:hrb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hrubri_3962 (paaJ)
Exosome [BR:hrb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hrubri_3962 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALU91112
UniProt: A0A0U3L5F2
Position
4663039..4664292
Genome map
AA seq 417 aa AA seqDB search
MAQAAFYSSFKDIWLIGGVRTPMVDYCTSFSQLSPTDMGIKVAREVLARTGIAATDIGSV
IAGNMAPGDAYQYMLPRHIGLYAGVPITTPAIMVQRICGTGFELIRQAGDQIERGYTETA
LIVGSESMTRNPIAAFDHRTGFKLGAPVQFQDYMWEALVDPAPGITMPQTAENLARKYGI
TRAEVDAYAAYSFERALKAQAAGFHAGEIVSVVNETFKLDGYHDRHIKLQGKISEASTDT
HPRPSPVDVLAKLRTLYPDGVQTGGNSSALVDAAAATIVASGDYLRRNDRQPLARVVAAA
VAGVPPEIMGIGPVPAIRTLLERNGLSVNDIGCFEINEAQGAQIVAVERELGLDRERLNV
NGGAIALGHPLAATGVRLSITAAREMNRRGARYSVASACIGGGQGIALLLENPSASH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagcagcgttctactccagcttcaaggacatctggctcatcggcggcgtgcgc
acgcccatggtggattactgcaccagcttcagccagctctcgcccaccgacatgggcatc
aaggtggcgcgcgaagtgctggcgcgcaccggcatcgccgccaccgacatcggctcggtc
atcgccggcaacatggcgccgggcgacgcctaccagtacatgctgccgcgtcacatcggc
ctgtatgccggggtacccatcaccaccccggccatcatggtccagcgcatctgcggcacc
ggtttcgaactgatccgccaggccggcgaccagatcgagcgcggctataccgagaccgcc
ctgatcgtgggcagtgaatcgatgacgcgcaatcccattgccgccttcgaccatcgcacc
ggcttcaagctgggcgcaccggtgcaattccaggactacatgtgggaagccctggtcgat
ccggctcccggcatcaccatgccacagacagcggaaaacctggccaggaaatacggcatc
acccgcgccgaagtggatgcctatgccgcctattcattcgagcgcgcattgaaggcgcag
gcggccggtttccatgcgggcgagatcgtgagtgtggtcaacgaaaccttcaagctcgat
ggctaccacgatcgccacatcaagctgcaaggcaagatcagcgaagcctccaccgatacc
catccgcgcccttcgccggtggacgtgctggccaagttgcgcacgctctacccggatggc
gtgcagaccggtggcaacagctcggcgctggtcgatgcggctgccgccaccatcgtcgct
tccggcgactacctgcgccgcaatgacaggcaaccgctggcacgcgtggtcgccgccgca
gtagccggcgtgccaccggaaatcatgggtatcggtccggtaccggccatccgcaccctg
ctggaacgcaatggcctgagcgtcaacgacatcggctgcttcgagatcaatgaagcgcaa
ggcgcgcagatcgtggcggtggagcgcgagctgggcctcgaccgcgaacgcctcaacgtc
aacggcggcgccatcgcgctgggccatccgctggcggcgaccggggtgcgcctgtcgatc
acggcagcacgcgagatgaaccgtcggggagcgcgctatagcgtggcttcggcctgcatc
ggcggtggccagggcattgccctgctgctggaaaatccctcggcttcccactga

DBGET integrated database retrieval system