KEGG   Helobdella robusta: HELRODRAFT_107485Help
Entry
HELRODRAFT_107485 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
hro  Helobdella robusta
Brite
KEGG Orthology (KO) [BR:hro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hro01002]
    HELRODRAFT_107485
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hro03110]
    HELRODRAFT_107485
Enzymes [BR:hro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     HELRODRAFT_107485
Peptidases and inhibitors [BR:hro01002]
 Serine peptidases
  Family S8: subtilisin family
   HELRODRAFT_107485
Chaperones and folding catalysts [BR:hro03110]
 Intramolecular chaperones
  Subtilisin family
   HELRODRAFT_107485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 20194910
NCBI-ProteinID: XP_009025510
JGI: Helro1_107485
UniProt: T1EEA8
Position
Unknown
AA seq 1345 aa AA seqDB search
MLSLDFPADGTLPKKETGAKSFLNKYPEYDGRNVVIAILDTGVDPGASGLQYTSDGRPKI
IDIYDATGTGDVNTSTIVKEQNGEIIGLTGRVLKIPASWNNPTRDYHIGLKVAYQVFPKS
LKERLTKEYKTEVFDVPHRAKLTQAYAQLDDFESKHIDPTQMDKLLKEDYQAQVEILQNM
DKKFDDCGPVFDCVVFHDGNTWRACIDTTCVGDLYLCKLLASYKEEREYGTFSESDMMNY
VLNVYNDGNLLEIVTNTGAHGTHVASIAAGYFENEPERCGVAPGAQIVSIKIGDGRLQNM
ESGTALVRAMIRVINSGIDMVNYSYGEASCWGDSGRVFDVINEAVHKYGLIFVAAAGNNG
PALSTVGSPGGTSYGIIGIGAYVSPDMMKASYSMREQLPTMHYTWSSRGPAFDGSLGVCV
SAPGAAITSVPNWTLKCSQLMNGTSMSSPNACGGIALLLSGLKQNDMPYTPYSIRRALEN
TAYVLPGVDHFTQGHGLIKVEEAFEYLRKFGDVAERNMRFVVTCGSHPGDRPLRGVYLRE
LSDVMAPSDHNISIEPIYIDKSVANQEKIQFNVTVALSCDVTWVQCPSHFQLMNDKRVFN
IRVNPLVLETGVHFTQILAYDISCIEKGPLFRIPITVIIPQKVEERPAFITTNVNLCNNS
NNSNSSIISNSSCSLLWANLNFKAGEIKRYFIHVPHGATRASLSVMSSPMEEQGAKLYIH
CTQLVHEKRYKYMNFEKFAHLDGDSIVKCEFPVVGGKTLELALARWWSYLGSITVNVHVE
FHSLLPDSIAPVMIVSEGIFRLDVTSFLQSEDISPAIILKHHVQPLRPCDNKIRCLLDER
DQLIGHPPINALELTYNFSRAKQGEVTPDFSLLNKLLYENEYESQMWMLYDANKQLLYCG
DAYTNMYTAKLEKGDYVLKMFIRHEKRDMLERLKDTPINLHHKLPSNINLDVYPNLQQAL
IAGKKFNCSVTLHKHHSLPVYTIAIHEDKLPKGVQPGHFLTGTISFSKDENAKKVEFFPF
KYVVPENIKKSKPPSTSTPSSSSSSPTSTPQPNINNISPPHPASPAAPVTNNVQTPTQNT
STLVSVEPPSIVPVDAVAKVDKSSRQTEFEVAVHEFKASWITKLDAEYSAQLFEELTYDR
PSDIVLYINRLIALDADKDRTKKLTQIIEVGEKAVTLLDINKIVSYFSIKNDAYQQQNIK
AAMEKSKSQLIDCLIRLGCALCDYLIEKRNSENEATLPPATTSTTTLSSNNNYTFSRVDE
IMSDVLKLTDVNESKVYQFNLRHAIVHQHYGRALKLLLKQADDKGNSLDIDEKIIEICGF
LHWDHLVKHLRRWLLVKYPASYLPF
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtttagatttccctgcagatggtactttgccaaaaaaggagactggtgcaaaa
tcatttcttaacaagtatccagaatacgatggtcgcaacgtggtcattgcgattcttgac
actggcgtagatccgggggcttcaggcttgcagtatacatctgatggcaggccaaaaatt
atagatatatatgatgcaacaggaacaggggatgttaacacttcaacaattgtgaaggaa
cagaatggagaaatcattggcttaactggcagagttttaaagataccagcaagctggaac
aatccaacaagggattatcacattggactgaaagttgcgtatcaagtgtttccaaaatca
ttgaaggagaggctcacaaaagaatataaaacagaggtgtttgatgtgcctcacagagca
aaactcactcaggcttatgcacagttagatgactttgaatctaaacatatagatccaact
cagatggacaagttgttgaaagaagattaccaagctcaagtggagatcctacaaaatatg
gataaaaagtttgatgattgtggtcccgtgtttgactgtgtggtctttcatgatggtaac
acttggagggcttgtattgacacaacatgtgtcggggacttgtacctgtgcaagctgcta
gcatcgtacaaagaggaaagagagtatggaacattcagtgaaagtgacatgatgaattac
gttttgaacgtttacaatgatgggaatctgttggaaattgtcacaaatactggcgctcac
ggaacacatgtggcttcaatagcagctggttatttcgaaaatgaacccgagaggtgtggt
gtggcacctggggcacagattgtttctataaaaattggagatggaaggctacagaacatg
gagtccggcacggctcttgttcgagctatgatccgagtgataaacagtggcatagatatg
gtaaactacagctatggagaggcatcatgctggggcgactcaggacgtgtctttgacgtg
ataaatgaggcagtgcacaagtatggattgatatttgtagcagcggctggcaacaatgga
cctgcactctcgactgttggaagccctggaggaaccagttatggtatcattgggattggt
gcttatgtgtctcctgacatgatgaaggccagctattcaatgagggaacagcttccaact
atgcattacacatggtcgtctaggggacctgcatttgatggctcattgggggtttgtgtg
tctgcccctggagctgctatcacctcagttcccaactggacactcaagtgctcgcaactg
atgaacggtaccagcatgagttcacccaatgcatgtggaggcattgctttgttgctgtcc
ggtttgaagcagaacgacatgccttacactccatacagtatcagaagggctcttgaaaac
actgcatatgttcttccgggtgtcgatcacttcacgcaaggtcatggactgatcaaggtg
gaagaggcttttgaatatttgagaaagtttggtgacgttgcagagcgaaacatgagattc
gtagtgacttgtggcagtcatccaggggaccgaccactgaggggggtgtacctgagggaa
ctgagtgacgtcatggcaccttccgatcacaacatctccatcgaacccatctacattgat
aagtctgtggccaatcaggaaaagattcagttcaacgtgactgtggccctatcctgtgac
gtcacatgggtccaatgccccagccactttcagttgatgaacgacaagagagtcttcaac
atcagggtcaatcctttggtccttgaaactggtgttcatttcactcagatattggcgtat
gacatatcgtgcatagagaagggacctctcttcaggattcctatcactgtcatcattcca
cagaaagtggaagaaagacctgcgttcataacgacgaatgtgaatctctgcaacaatagc
aacaacagcaacagcagcatcatcagtaacagtagttgttctctgctctgggccaacctg
aacttcaaggctggcgaaatcaagcgatacttcattcacgtgccgcatggcgctactagg
gcctccctttcggtgatgtcctccccaatggaggagcagggggccaagttgtacatccac
tgcacgcagctggtgcacgagaagaggtataagtacatgaactttgagaagtttgcccat
ctcgatggagattccatcgtcaagtgtgaattccctgtcgtgggaggcaaaacattggag
ctggcactggcccgttggtggtcctatctcgggagcatcacggtgaatgttcatgttgag
tttcattccttactgcccgactccattgcccctgtcatgatcgtatcagagggtatattc
agacttgacgtaacttcattcttgcagtcggaggatatctcgccagccatcatcctcaaa
catcacgtgcagcccttaagaccatgtgacaacaagattcgttgtttattggacgagaga
gaccagctgataggccacccgccaatcaatgccctcgaactcacctacaacttctccaga
gccaaacagggggaggtgacgcctgacttcagtttgctgaacaagttgctgtacgagaat
gaatatgaatctcaaatgtggatgctgtacgacgcaaacaaacaactactctactgcgga
gacgcatacacgaatatgtacacggctaagctggagaaaggagattatgtattgaagatg
ttcattcgtcacgagaagagagatatgctggagaggctgaaggacacccccatcaacttg
caccacaaacttccttcaaacatcaacctggacgtctatcccaatcttcagcaagcactg
attgcaggcaagaagttcaactgctctgtgactcttcacaagcaccacagcctgcctgtc
tataccatagctatccatgaagataagttaccaaaaggagtccaacctggtcactttctc
acgggcaccatatccttctctaaagatgagaatgccaaaaaagtggagttttttccgttc
aagtacgtggtaccggagaacatcaagaagtcgaaacctccttcaacatcgacgccatcg
tcatcctcatcatctcccacaagcactccacagccaaacatcaacaacatatcaccacca
catccagcatctccggcggcgccggtgacaaacaacgttcagacgcctactcagaacact
tccactttggtttccgttgaaccgccatccatcgttccggttgatgcagtggccaaggtg
gacaagtcctcgaggcaaacggaatttgaagtggctgtgcatgagttcaaggcttcgtgg
atcaccaaattggatgccgagtattcagcgcagttgtttgaggagctgacgtacgaccga
ccttccgatatcgtcctttacatcaaccgactgattgctctcgacgccgataaggaccgc
accaagaagctgacccaaattatcgaggtgggtgagaaggcggtcaccttactggacatc
aacaagattgtctcttacttcagcattaaaaatgatgcttaccaacagcaaaacattaag
gcagcaatggagaagagcaagtctcagttaattgattgcctcatacgacttggatgcgcc
ctctgtgactaccttatcgagaagcgcaactcggaaaacgaggccaccttaccacctgca
acaacatctaccacgaccctctcatctaacaacaactacacgttctcgcgtgttgatgaa
atcatgtcagatgttctcaaattgactgacgttaacgaatctaaggtgtaccagttcaat
ctgaggcatgcaattgtacaccaacattacggaagggcactgaagctgcttctaaaacag
gcagacgacaagggaaattctctcgacattgatgagaaaattattgaaatctgtggcttt
ttgcactgggatcacctggtgaagcacctccgaaggtggctcctcgtcaaatatccagca
tcctacctaccgttttaa

DBGET integrated database retrieval system