KEGG   Helobdella robusta: HELRODRAFT_108482Help
Entry
HELRODRAFT_108482 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
hro  Helobdella robusta
Pathway
hro00561  Glycerolipid metabolism
hro01100  Metabolic pathways
Module
hro_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    HELRODRAFT_108482
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hro01002]
    HELRODRAFT_108482
Enzymes [BR:hro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     HELRODRAFT_108482
Peptidases [BR:hro01002]
 Serine Peptidases
  Family S33
   HELRODRAFT_108482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_2 Peptidase_S9 PGAP1 Abhydrolase_5 Thioesterase Lipase_3 DLH Esterase FSH1 Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 20194997
NCBI-ProteinID: XP_009030539
JGI: Helro1_108482
UniProt: T1EEJ5
Position
Unknown
AA seq 288 aa AA seqDB search
MAGPVEALVCCRDSTLTSDHGHQLFCKFWRSSDDKPRRLIFISHGLAEHCQRYDDLAVPL
AQHDNFVYAHDHVGHGRSEGDRVHVTDFSIYVDDVIKHIEMLKKEHPGVPCFMFGHSMGG
LITILTTLRAPDLLKGIVLSGPAITHDSNIVTPLKTFLAKAVAMIWPQYEFASVGSEVIC
RDEKVVYYYNEDQLVWHGGIKAKWFSCIMAAMEEVQTRFREIKTPYLLLHGSADQLCSIE
GSKMMHANTSSEDKTFKIYEGCYHEVLWEIDGQGKQAIKDVVDWIENR
NT seq 868 nt NT seq  +upstreamnt  +downstreamnt
gatggcgggaccggttgaagctctggtgtgttgcagagattctacactgaccagcgatca
cggacaccaattgttttgtaaattttggagatcgtcggatgacaaacccaggcgtttgat
cttcataagtcatgggcttgctgaacactgccagcgttacgacgatttagccgtgccatt
agctcagcacgataattttgtttatgcacatgaccatgtgggacatggcagaagtgaagg
tgatcgagtgcatgtcactgacttctctatttatgttgatgatgttataaaacatattga
gatgttgaaaaaggagcatcctggagttccatgtttcatgttcggtcattccatgggtgg
attgattactattctgaccacacttagagcacctgacctgcttaagggaattgttttgtc
gggcccagccatcacgcatgacagcaatattgtaactcctctcaaaacttttctagctaa
agctgttgctatgatatggccccagtatgaatttgcatcagtaggttctgaagttatttg
tagagatgaaaaagtggtatactactacaacgaagatcaattggtctggcatggtggaat
aaaagccaaatggttcagctgcattatggccgccatggaagaagtgcagacgaggtttag
agaaataaaaactccatacttgctgctgcacggttctgccgaccagttgtgtagcattga
aggatcgaagatgatgcatgcaaataccagcagtgaagacaagacttttaagatatatga
aggatgctatcatgaagttttgtgggagattgatggccagggaaagcaagcgatcaagga
tgttgttgactggatcgaaaacagatga

DBGET integrated database retrieval system