KEGG   Helobdella robusta: HELRODRAFT_108615Help
Entry
HELRODRAFT_108615 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
hro  Helobdella robusta
Pathway
hro00360  Phenylalanine metabolism
hro00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hro00790  Folate biosynthesis
hro01100  Metabolic pathways
hro01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    HELRODRAFT_108615
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HELRODRAFT_108615
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HELRODRAFT_108615
Enzymes [BR:hro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     HELRODRAFT_108615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT YfiO
Motif
Other DBs
NCBI-GeneID: 20195012
NCBI-ProteinID: XP_009031440
JGI: Helro1_108615
UniProt: T1EEL0
Position
Unknown
AA seq 446 aa AA seqDB search
MMGERTNEAYIATTKSAEASPVVPESCTKLVFSVEESVGALAKALRAFEKFNVNLLHIES
RPSKQSLNKYDFFIDCDNSQGGLDDALKELKTITSDVDVLARVVKQPDVVPWFPHKIQDL
DVFANQILSYGSELDADHPGFKDPVYRARRKEFADIAYNYRHGQPIPRVEYTKEEIETWG
TIYKELTKLYPTHACQEFNHIFPLLIDNCGFREDNIPQLEDVSNFLKDCTGFTLRPVAGL
LSSRDFLAGLAFRVFHSTQYIRHPSVPMYTPEPDVCHELFGHVPLFADEGFAQFSQEIGL
ASLGAPDEYIAQLATCYWFTVEFGLCRQNGHLKAYGAGLLSSFGELEYCLSGKPEIKAFD
PDQTGVQEYPITKFQPVYFTTESFAEAKAKLKAFAKKIPRKYTVRYNAYTSSIEALDNSR
QIGNFAAKIKTDVETLEEALKKISHR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgatgggagaaagaacgaacgaagcttacatagcaacaacgaaatcagcagaagcctcc
cccgtcgttccagagtcatgcaccaaactcgtcttctccgtcgaagaatcagtcggtgca
ctcgctaaggcgttgagggcgtttgagaaattcaacgtcaacttgttgcacattgaatcg
agaccatcgaagcagagtttgaacaagtacgacttcttcatcgactgcgacaactcacaa
gggggtctggacgatgccctgaaagaattgaaaaccatcacttctgatgttgatgtcctg
gccagagtggtcaagcagcctgatgttgtgccctggttcccacacaagatacaagacctg
gatgtcttcgccaatcaaatcctttcttacggatctgaactggatgcagaccaccctggc
ttcaaggatccagtgtacagagcacgaaggaaagagtttgcagacatcgcatacaactat
cgacatggtcagccgattccgagagtagaatacacgaaagaagaaatagagacatggggc
acaatatataaggagctgacgaaactctaccccacacacgcctgccaggagttcaaccac
atattccctctcctcatcgacaactgtgggttcagggaggacaatataccccaactcgaa
gatgtctcaaacttcctcaaagattgtacgggatttacattgcgaccagttgcaggtctc
ctgtcgtccagagatttcttggcaggtctggccttcagggtcttccattcaacgcagtac
atcagacatccatctgtccccatgtacacacctgagccagacgtttgtcacgagttgttt
ggtcacgtgcccctctttgctgatgaaggatttgctcagttctcgcaagagattggactc
gccagtttgggagcacctgatgagtacatcgcacagctggctacgtgttattggttcact
gtcgaatttggactgtgcagacagaatggccatttgaaagcttacggagctggtctgctc
tcctcatttggagagttggaatactgcttgtctggcaaacctgaaataaaagcattcgat
cctgaccaaacaggtgtccaagaataccccatcactaagttccagcctgtctattttact
actgaaagttttgctgaagctaaagccaagctgaaagccttcgctaagaagatcccaagg
aagtacacggtgcgatacaacgcatacacctcatccattgaggctctggacaacagcagg
caaatcggaaactttgcggctaaaattaaaactgacgttgagacgctggaagaagcgctg
aagaaaataagtcacaggtaa

DBGET integrated database retrieval system