KEGG   Helobdella robusta: HELRODRAFT_108666Help
Entry
HELRODRAFT_108666 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
hro  Helobdella robusta
Brite
KEGG Orthology (KO) [BR:hro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hro01001]
    HELRODRAFT_108666
Enzymes [BR:hro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HELRODRAFT_108666
Protein kinases [BR:hro01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   HELRODRAFT_108666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 20195015
NCBI-ProteinID: XP_009031489
JGI: Helro1_108666
UniProt: T1EEL3
Position
Unknown
AA seq 351 aa AA seqDB search
MGEAHSKGWQPKTNSLSDDYKVLSKVLGLGINGKVVECISRSSGQVYALKVLKDSPKARR
EVELHCRASGCEYIVNIIDVYENTISGQKCLLLVMECMSGGELFNRIQEHSDSPFTEREA
ADIVYQICMALDFLHSNDIAHRDLKPENLLYTSHKPDAKLKLTDFGFAKVTNAHKSLQTP
CYTPYYVAPEVLGPEKYDKSCDMWSLGVITYILICGYPPFYSDHGQPISPGMKKRIRNGK
YEFPKEEWSRVSKDAKDLIKGLLITEPDKRLTIKEVMHHNWVAQHTLVPPTPLVSVQVLK
EDKANWVDVQDEMTNALATMRVDYEQAPIKRLDESKNPILEKRKKKQVAPK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaagctcactcaaaaggttggcaaccgaagacaaacagcttgtcagatgattac
aaagtgttgagcaaggtcctaggtctgggaatcaatggcaaagtcgttgagtgcatcagt
agatcgtcgggacaagtttacgctttaaaagtcctaaaagattccccaaaggcacgaagg
gaagtagaattacactgcagagcatctggttgtgaatacatcgtcaacattatcgacgtc
tatgaaaatacaatcagtggtcagaagtgtctgctactcgttatggaatgtatgagtgga
ggagaactcttcaatagaattcaagagcattcagactccccattcacagaaagagaggca
gcagacattgtataccagatttgtatggcactagacttccttcactccaatgacattgcc
catcgagatctcaagccagaaaatctcctatacacaagccacaagccagacgccaaactc
aagttgaccgattttggttttgccaaagtgacaaatgctcataaatccttacaaactcca
tgttacactccatactatgtcgctccggaggtcctgggcccagagaagtatgacaaatca
tgtgatatgtggtcgctcggtgtcatcacctacatattaatttgcggctaccctccattc
tacagtgaccacggccagccaatctctcccggcatgaagaagaggattaggaatgggaag
tacgaattcccaaaagaggagtggtcaagagtgtccaaggatgctaaagacctgataaaa
ggcttgttgataacagagccggataagaggctaaccatcaaggaagttatgcaccacaac
tgggttgctcaacacacattagtgccacccactccattggtctccgtacaagtcctcaag
gaagacaaagccaactgggtagatgttcaggatgaaatgaccaatgctctggccaccatg
agagtggactacgaacaggccccgataaaaaggctcgacgaatcaaagaacccgattctt
gagaagaggaagaaaaagcaagtggcgccaaaataa

DBGET integrated database retrieval system