KEGG   Helobdella robusta: HELRODRAFT_111140Help
Entry
HELRODRAFT_111140 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
hro  Helobdella robusta
Pathway
hro00030  Pentose phosphate pathway
hro01100  Metabolic pathways
hro01200  Carbon metabolism
Module
hro_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hro_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HELRODRAFT_111140
Enzymes [BR:hro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     HELRODRAFT_111140
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     HELRODRAFT_111140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N CoA_trans
Motif
Other DBs
NCBI-GeneID: 20195239
NCBI-ProteinID: XP_009016354
JGI: Helro1_111140
UniProt: T1EF87
Position
Unknown
AA seq 452 aa AA seqDB search
MDKCEDVACHKAKKGFSETVQYVQLKSSKHFKELAMKINENTQSLYGLVGSPNTYEVGRL
FYLAIPPSAYAETAERIHKYLLPEHGRGWVKIVVEKPFGRDLNSAKLLNSGLLKRFDESQ
IYRVDHYLGKTVVKMILPFRVINSNSYSQLWNADYIDRVEIVMKEELDVVGRTQFYNENG
VVRDVMQNHLTELFMLTAMQLPSSGGVNISEIHELKYDLLKKVKLPKMDKILLGQYSTYN
VEWLAENKETNKITDTPTFAATTFYVDSEMWRGVPFLFMSGKKLNEKTSYVRIVLKNRKF
CLNHNAEFCKDDKQIVFYIGGKFGEFIAVSKDLPLPSFRSGWKKKTSTAFKDVFGQSTDE
MHLFFPVEEVESYTELIKSIIKGARHMFVPSSILYQSWQVWSSLLEVSDSTRPRIYIGKD
KDPERLDFYFDTLTDGLKFVIKEPSPNQTTST
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggataaatgtgaagatgtggcttgccataaagcaaaaaaaggtttctctgaaacagtg
caatacgttcaattgaaaagttcaaagcatttcaaagaacttgccatgaaaattaacgaa
aacactcaaagtctctacggtttggttggttccccaaatacctatgaagtaggaagactc
ttctaccttgccataccaccttcagcttacgccgaaacagccgagagaatccacaaatat
ctgctgcctgaacatggaagaggttgggtgaaaatagttgttgagaagccgttcgggcga
gatttaaacagcgctaagcttttaaacagcggtcttctgaagcgatttgatgagtctcaa
atatatagagtagatcattatcttggaaagaccgtggtcaagatgattctaccatttagg
gtaataaattccaattcttactctcagctatggaatgcagattatattgatagggttgaa
atagttatgaaggaggaacttgatgttgttggcagaacacagttttataatgaaaacggt
gtggttcgcgatgtaatgcagaatcacctcactgagctcttcatgttgacagccatgcag
ttaccttcctctgggggtgtcaacattagcgagatacacgaactgaaatatgatctattg
aagaaggttaaacttcccaaaatggataaaattttattgggtcaatattcaacatataac
gttgaatggttggcagaaaacaaagaaacaaacaagattacagatacacctacgtttgca
gccacaacattttatgttgattcagaaatgtggagaggcgtaccttttcttttcatgagt
ggcaaaaagttgaacgagaaaactagttatgtcagaatagttttgaaaaatcgaaaattt
tgcctcaaccacaatgctgaattttgcaaagatgacaaacaaattgttttttatattggt
gggaaatttggagagtttattgccgtgtcaaaggaccttccgttacctagtttcagatcc
ggttggaagaaaaagacatcgacagcgttcaaagatgtttttggacaatcaactgatgaa
atgcatctcttttttccagttgaggaggttgagtcatacactgagctcatcaaaagtatt
ataaagggggctagacatatgttcgttccctctagcattctttatcagtcttggcaagtg
tggtcttcgctgctagaagttagtgatagcacaagacctagaatatatataggaaaagac
aaagaccctgagcgacttgatttttattttgacactttaactgacggattgaaatttgtt
ataaaagaaccatctccaaaccaaacaacttctacctga

DBGET integrated database retrieval system