KEGG   Helobdella robusta: HELRODRAFT_140496Help
Entry
HELRODRAFT_140496 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hro  Helobdella robusta
Pathway
hro04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    HELRODRAFT_140496
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hro04030]
    HELRODRAFT_140496
G protein-coupled receptors [BR:hro04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    HELRODRAFT_140496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srw 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 20196563
NCBI-ProteinID: XP_009020383
JGI: Helro1_140496
UniProt: T1EJ13
Position
Unknown
AA seq 366 aa AA seqDB search
STTGNSLVIAAIALERYLQNVANYLIASLAVTDLLVAVLVMPLAAKKQVITGVWLLGRAA
CDAWTSMDVLCCTASILHLVAIALDRYWAVTKVNYVHHRPLKTIVVMIILSWGISAIICL
PPLMGWRQNGDQTPFLNCMISQDPVYTIYSTVGAFYLPLVVIIIIYISVYRAAKRRIRKN
ILNGESSKKSVECVHNNDHRYFKNISNKKERAKKKSKKYDKNVKVEMMKNRHSSFQNILS
VLKVKKLSLPTTSATKITSTMSSQQIFHKNVEELSIQNQTTKKNSARERKAARTLAVITG
SFVICWLPFFLLALIEPFCGDVCRVPYILASFINWLGYCNSLLNPIIYTVFSGDFRRAFR
KILLCR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
tccacaacaggcaattcgctggtcatagcagcaatcgcgctggaacgctaccttcaaaat
gtagccaactacctgatagcttcattggccgttaccgaccttctagtagccgtcttggtg
atgccactggctgccaagaaacaagtaataacaggcgtgtggctgctgggtcgagcggca
tgtgacgcttggacgtcgatggacgtcttgtgctgcactgcctccatcctacaccttgtg
gcaatcgcactggacaggtactgggctgtcaccaaagtcaactatgtacaccatcggccc
ctcaaaaccatcgtcgtcatgatcatccttagttgggggatctccgccattatctgcttg
cctccactaatgggatggaggcagaatggtgatcagacccccttcttaaactgcatgatc
agccaggatccagtctataccatctactccactgtcggagccttctacctgccactcgtc
gtcatcatcatcatctacatcagcgtctacagagcggccaagcggagaatcaggaagaac
attttgaatggtgaaagtagtaaaaaaagcgttgagtgcgtacataacaatgatcacaga
tattttaaaaacatctcaaataagaaagagcgagcaaagaaaaaatcgaaaaaatatgat
aagaatgtgaaagttgaaatgatgaaaaaccggcattcaagttttcaaaacattctgtcc
gttttgaaagtaaaaaaattatcactgccaacaacttccgcaacaaaaataacttcaaca
atgtcgtcgcaacaaatttttcacaaaaatgttgaagaactttcgattcagaatcaaaca
acgaaaaaaaattcagcgagagagaggaaggccgctcgtacgttggccgtcatcaccggt
tccttcgtcatctgctggctgcccttttttctactggccctgatagaacctttctgtgga
gacgtgtgtcgcgtgccatacattctggccagtttcatcaactggttagggtattgcaac
agtctccttaatccgattatctacaccgtcttcagcggggacttcagaagagcttttcga
aaaattttgctttgccga

DBGET integrated database retrieval system