KEGG   Helobdella robusta: HELRODRAFT_161517Help
Entry
HELRODRAFT_161517 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
hro  Helobdella robusta
Pathway
hro00010  Glycolysis / Gluconeogenesis
hro00562  Inositol phosphate metabolism
hro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELRODRAFT_161517
   00562 Inositol phosphate metabolism
    HELRODRAFT_161517
Enzymes [BR:hro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     HELRODRAFT_161517
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     HELRODRAFT_161517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 GCR1_C
Motif
Other DBs
NCBI-GeneID: 20199210
NCBI-ProteinID: XP_009019677
JGI: Helro1_161517
UniProt: T1ERL0
Position
Unknown
AA seq 463 aa AA seqDB search
MYATKTTYQNSFKNGIPKKFEKPGGCRPVQVIALYRHGTRFPSLKNMKTVDRLLTEFVED
YPNNVTVRSMKEVFDREFHFSEDNELSRGGARELIDIGKRVATNFNQLFKNCKAGELLFK
SSSTERAFDSCSYFQEGFSKVIPFEGSTTITDDFLLRFFDKCSNYITSIKKDKLALKECE
DFQKNSYQEINRLMEKKLNFKVDLKRKEQLVMFSIAGCAYAFVGDTVWSTIFPEEARSML
EYSIDLKKYYDSGYGHEISSLQSCHLFSTFFRHIDSFIENRLKLKGVFYFAHAETLLPVM
CLMGLFKDDEPLRHDNYERMRTRLFRTSFICSFAANIMIVLYDCNKIYKVQVLHNEKAIR
LPPPLQPDDKLLYSYSDFKNHYKDVLNRKFNDVCRLEESKSSSSSFSEEMSFSTISGTPS
KSQSFSRVSKETTGGSEQSSQSQHDSSSSRSVSLDETISNFSR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatgccaccaagactacgtaccaaaattcttttaaaaatggcataccgaagaagttt
gagaaaccaggaggatgccgaccagttcaagtgattgctctctacaggcatggcacacgc
tttcctagtcttaaaaacatgaaaaccgtggatcgactgctgactgaattcgtggaagat
taccccaacaatgttacagtgaggagtatgaaagaggtttttgatcgtgaattccacttc
agcgaagacaatgaactatcgagaggcggggctcgggaactcattgacatcggcaagagg
gtagccaccaatttcaaccagttatttaaaaattgtaaggcaggcgaattattatttaaa
tcaagttccactgaaagagctttcgatagctgcagctatttccaagaaggtttctcaaaa
gttattccgtttgagggcagcaccacaatcactgacgattttcttttgagatttttcgat
aaatgttcaaactacataacttcgatcaaaaaagacaaacttgccttgaaggaatgtgaa
gattttcagaaaaattcttatcaagaaatcaatcgactgatggagaaaaagctaaacttt
aaagtggatcttaaaagaaaggaacaattagtgatgttcagcatagctggatgtgcatat
gcatttgttggcgatactgtttggagcaccattttcccagaagaagcaagaagtatgcta
gaatattctattgatcttaagaaatattacgattcaggttatgggcacgaaataagcagt
ctccagagttgccacttattctcaacattttttcggcacatagacagcttcatcgagaac
aggttgaaactgaagggtgtcttttatttcgctcacgcggagacactgctgccagtgatg
tgtctgatgggattgttcaaggacgacgaacctctgagacacgacaactacgaacgcatg
agaaccagactcttcagaacaagtttcatatgttcgtttgccgcaaatataatgattgtg
ttgtacgactgcaacaaaatttacaaagtacaagtcctccacaatgagaaggccatacgt
ctgccaccgcccctacaaccagacgacaaactcttgtacagctactcagattttaaaaac
cactacaaagatgttttgaatcgcaagttcaatgatgtctgtcgtcttgaagaaagcaaa
agttcttcctcaagtttttctgaagaaatgtcgttctcaacaatttctggtacaccttcc
aaatcacaatcattttcaagagtctcgaaggaaacgacaggcggatcggagcagagttct
caatctcaacacgactcaagttcatcgcgttccgtctcactagatgaaacaatttctaat
ttttcacgatga

DBGET integrated database retrieval system