KEGG   Helobdella robusta: HELRODRAFT_169373Help
Entry
HELRODRAFT_169373 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
hro  Helobdella robusta
Pathway
hro00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    HELRODRAFT_169373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 20202803
NCBI-ProteinID: XP_009013442
JGI: Helro1_169373
UniProt: T1F1V3
Position
Unknown
AA seq 405 aa AA seqDB search
MDDLLNVKCFVLVSVLIICSVSVSSTALADQFHEELFIKTLPTGQLYNHFRFTTIWNVSL
NSSQSKHYRLFPRALGEVFETFSVKELSLSFTQGRWRHESWGYPVLDASKGAELLVWFSA
QKTKIDSAWSELVNVLSGMFCASLNFMDVKTTVTPKLNFRPTGYVTENYKKYFSNHVRYA
VLSNENVCTENLTPWKKLLPCGFRAGLSTLLNAFKLYDSSYHSLNVQFRHVCLNEKIEPL
KIFYQPGKDNGRPYHLEVLFNLPANSVARLSFQFEKQLLKWTDYPPDPNHGFYIAPSVIN
FILPNAGNITSLKNNKHFFTGLKNSNKNDAYTFTLHTEALLITLPTPDFSMPYNVICLVC
TVIAIAFGSVHNLTTKSFVMYDPQKHKNIFRKLKDKFWKKKEKLS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggatgacttgctgaatgttaagtgttttgttttagtttcagttttaataatttgttcg
gttagtgttagttcgactgcgcttgctgatcagtttcacgaagaactttttattaagaca
ttaccaacaggacagttatacaatcattttcggtttacgactatatggaatgtttccttg
aactccagccaatcaaagcattacaggttgtttccaagagcccttggagaagtttttgaa
acattttctgtgaaagagttgtctcttagttttactcaaggtcgatggcgacacgaatct
tggggttatccggtattagatgcgtcaaaaggagctgaattgttagtttggttttctgct
caaaaaactaaaattgattcagcctggtcagagttagtcaatgttctctcaggaatgttt
tgtgcttccctaaattttatggatgtgaaaacaacggtgaccccaaagttaaatttcagg
ccaacaggttatgtaacagaaaattacaaaaagtatttttctaaccacgtgcgttatgca
gttttgtctaatgaaaatgtctgtacagaaaatttgacaccgtggaaaaaattattgcca
tgtggttttagagcaggtttatcgacgttgctgaatgcttttaaactttatgattcatct
taccattctctcaatgttcagttcaggcatgtttgcttaaacgagaaaattgagccttta
aaaatattctatcaacctggaaaagacaatggtaggccgtatcatttagaagttttgttc
aacttaccagctaattctgtggctaggttgagttttcaatttgaaaaacagttactgaaa
tggactgattatcctcctgatccaaaccatggtttttatattgcaccatcagttataaat
ttcattttgcccaatgctggaaacataacttcattgaaaaacaacaaacatttttttact
ggcttgaaaaacagcaataaaaatgatgcttatacattcacgttacacactgaagcgctt
ctcatcacattaccaactccagatttcagcatgccttacaatgttatctgtctcgtttgc
actgttatagccattgcttttggatctgttcataacttaactacaaaaagttttgtgatg
tatgatccacaaaaacacaaaaacattttcagaaaactgaaagataaattttggaaaaag
aaagaaaaactttcgtga

DBGET integrated database retrieval system