KEGG   Helobdella robusta: HELRODRAFT_181936Help
Entry
HELRODRAFT_181936 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
hro  Helobdella robusta
Pathway
hro00071  Fatty acid degradation
hro00592  alpha-Linolenic acid metabolism
hro01040  Biosynthesis of unsaturated fatty acids
hro01100  Metabolic pathways
hro01212  Fatty acid metabolism
hro04146  Peroxisome
Module
hro_M00087  beta-Oxidation
hro_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HELRODRAFT_181936
   00592 alpha-Linolenic acid metabolism
    HELRODRAFT_181936
   01040 Biosynthesis of unsaturated fatty acids
    HELRODRAFT_181936
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    HELRODRAFT_181936
Enzymes [BR:hro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     HELRODRAFT_181936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX
Motif
Other DBs
NCBI-GeneID: 20208270
NCBI-ProteinID: XP_009029951
JGI: Helro1_181936
UniProt: T1FHH1
Position
Unknown
AA seq 477 aa AA seqDB search
MAQLITDGSNHGVHPFVCQLRDVDTHLPLSGIELGDIGTKQGWNGIDNGYLRLDNVRVPR
TNMLMKYFVVHKDGRYERIGSNDKAIYSTLIYARSLCASFYGGRMVIMAASVAIRHCLVM
KCDKYGSLFENRFVKNTLVTELASGLAIWLAGNALSNEYKRLLPRIMDGDSSPLPALHAI
SSGYKALSTYLGPEGVERCRRCCGQVGGLVASGLPIISETVSPGVTIDGDNTVMYLQLAR
YLVKLERRRREDGDSKNERGDDVDNEFDSSGPNSKSFALHMIKLHGLKSQKLIEQAYDRM
TSLVTSEGLPLYEAWNRTSVDLVQAAEAYTISYAVKSFYDVIMSCGNDQDGGPDRDDEDL
KNVLFDVLCLFAVHSFVSSVNVCYHLLTDKLPTSNLSDLRQSIDKMVDKLAPNALALSDG
LDLSDAELDTCIGTYCGNTDADIFNYVADVQPYNAKPDLLKPVLEGLRNYFKLRSRL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgattaccgacggttcgaatcacggggtacatcccttcgtctgccaactt
cgagatgtcgatacacatttaccgctatccgggatcgagttgggagacatagggaccaaa
cagggatggaatgggatcgacaacggatacctgaggttggacaacgtgagggtaccaaga
accaacatgctcatgaagtatttcgtcgtgcacaaagacggtcggtacgagcggatcggg
tcgaacgataaagccatctactcaaccctgatctacgccagatcattgtgcgccagtttt
tatggcgggagaatggtcatcatggccgcctctgtggccattaggcactgcctggttatg
aaatgcgataaatacggttctctattcgagaatcgattcgtgaagaatacactggtcacc
gaactggcaagcggcctcgccatctggctggccggcaatgctctctccaatgaatacaaa
cggttgctaccgagaatcatggatggagactcgagtcctctaccagcgctccatgccata
tcgtccggatacaaagccctttcgacatatttgggccctgagggggtggagaggtgcaga
agatgctgtggtcaggtcggaggtttggtggccagtggactgccaatcatctccgagact
gtctcgccaggtgtcaccattgacggcgataatactgttatgtatttgcaacttgctaga
taccttgtaaagttggaacgaagaagaagagaagacggagattcaaagaacgaaagaggt
gacgatgttgataacgaattcgattcgtccggtcctaactccaaatcattcgctctccat
atgatcaaattgcacggtctaaaatcgcaaaaactaatcgagcaagcttatgacagaatg
acgtcactagtgacgtcagagggcctgccactatacgaggcctggaatcgaacctccgtc
gatctagtgcaagccgcagaggcctacacaatttcatacgccgtgaaaagtttctatgac
gtcataatgagttgtggtaatgatcaagatggcggaccggatagggatgatgaagatttg
aagaatgttctttttgatgttctctgcctgttcgccgttcactcgttcgtcagtagtgtg
aacgtttgttatcatcttctgacagacaaactaccaaccagcaacctatcggatctacgt
caatcaatcgacaaaatggtggacaaattggcgccaaatgctctagctctcagcgatgga
ctcgatttgagtgatgccgagttggacacttgcatcggaacttattgcggtaatacagac
gctgatatatttaattacgtggctgatgttcaaccttacaacgctaaaccagacctcttg
aaaccagtgctggaaggtctgagaaactacttcaaactgaggtcgagactttga

DBGET integrated database retrieval system