KEGG   Helobdella robusta: HELRODRAFT_184857Help
Entry
HELRODRAFT_184857 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
hro  Helobdella robusta
Brite
KEGG Orthology (KO) [BR:hro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hro01002]
    HELRODRAFT_184857
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hro04147]
    HELRODRAFT_184857
Enzymes [BR:hro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     HELRODRAFT_184857
Peptidases [BR:hro01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   HELRODRAFT_184857
Exosome [BR:hro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   HELRODRAFT_184857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_2 Thioesterase LIDHydrolase Chlorophyllase2 Abhydrolase_3 Peptidase_S15 Lipase_3
Motif
Other DBs
NCBI-GeneID: 20209882
NCBI-ProteinID: XP_009009692
JGI: Helro1_184857
UniProt: T1FM33
Position
Unknown
AA seq 394 aa AA seqDB search
MFRNNKSSDSSTDYSCYKGITPRPPIHPRTTNNVGERGDARDGHTDGSHHHPSAASQSNL
TKPHNIFVVFLLKFCGYLLLLLFFIIPAVIKIYPSILGLVVFCNYVKLPFGLVDYQNTTL
HGLNNAYNFHLQVNEKVSLGAWHILPKDLKVPKNVELKASSVNDLLDNDNAIVLYLHGNA
GDRTKSFRVNLYKTLSSRGFHVIAFDYRGYGDSSSWPSKSGLVEDASVMFDWLKKTARKK
ANIFIWGHSLGSAIAVELAKDLGNKGITFSGLVLETPFTNAIELADTHFITTFFRWLPYY
SWVVVDAVKQADITLPNDQNILDVKEKILILHAEDDQIVPYTHGKKLYEVAKTRTKDPNM
TKLITYESKLGYGHKKISTNPNLMDDFVSFMGIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaataataaaagtagcgattcgagcacagattacagttgttataagggcatt
acacctaggcctccaattcatccacgaacgacgaataatgttggagaacgtggcgatgcc
cgtgatggacacaccgacggttctcaccaccatccgtctgctgcttcacaatcgaatctc
actaaaccccacaatatatttgtagtttttctactcaaattttgtggctatctgttgctt
ctgttatttttcatcattccagctgttataaagatttatccatcgatattgggtctggtt
gttttctgtaattatgtgaaattgccttttggtttagttgattaccagaacacaacgctc
catggcttaaataatgcctataattttcatttacaagttaatgaaaaagtttcccttggt
gcttggcatattcttccaaaagatttaaaagtcccaaagaatgttgaactgaaggcatcg
agtgttaatgacctgctcgataatgataatgccattgtgttgtatctgcacggcaatgct
ggagacagaaccaagtctttcagagttaacttgtacaaaacactgtcatccagaggcttt
catgtcattgcatttgattacagaggttatggtgattcgagcagttggcccagcaagtcg
ggattggttgaggatgcttctgtaatgtttgactggttgaaaaaaacagccaggaagaaa
gccaacattttcatctggggccattccttgggatcagcgattgctgttgaacttgctaag
gaccttggcaataaaggaataacattttctggtctggtgttggagactccattcacaaat
gccattgaacttgctgatacacatttcatcactactttttttagatggctgccatactac
agttgggttgtagttgatgctgtgaaacaggctgacattacattgcctaatgatcaaaac
atcttggatgtgaaagaaaaaattctgatcttacatgcagaggatgaccaaatagtgcca
tacacacatgggaagaagttgtatgaggttgccaaaactcgcaccaaggatcccaacatg
accaagttaataacttatgaaagcaaattgggatatggacacaagaagatatcaaccaac
cccaacctcatggatgattttgtttcattcatgggaattaaataa

DBGET integrated database retrieval system