KEGG   Helobdella robusta: HELRODRAFT_185327Help
Entry
HELRODRAFT_185327 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hro  Helobdella robusta
Pathway
hro00010  Glycolysis / Gluconeogenesis
hro00030  Pentose phosphate pathway
hro00051  Fructose and mannose metabolism
hro01100  Metabolic pathways
hro01200  Carbon metabolism
hro01230  Biosynthesis of amino acids
Module
hro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hro_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELRODRAFT_185327
   00030 Pentose phosphate pathway
    HELRODRAFT_185327
   00051 Fructose and mannose metabolism
    HELRODRAFT_185327
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hro04131]
    HELRODRAFT_185327
   03036 Chromosome and associated proteins [BR:hro03036]
    HELRODRAFT_185327
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hro04147]
    HELRODRAFT_185327
Enzymes [BR:hro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HELRODRAFT_185327
Membrane trafficking [BR:hro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HELRODRAFT_185327
Chromosome and associated proteins [BR:hro03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    HELRODRAFT_185327
Exosome [BR:hro04147]
 Exosomal proteins
  Proteins found in most exosomes
   HELRODRAFT_185327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 20210090
NCBI-ProteinID: XP_009012070
JGI: Helro1_185327
UniProt: T1FMP1
Position
Unknown
AA seq 363 aa AA seqDB search
MPRFVDALSKEKKEELSRIAKAIVAPGKGILAADESTATIGKRFANIGLENNEDNRRKYR
QLLFTSGKDLHQYISGVIMFHESFYQKSDCGKPLPVLLKEQGIIPGIKVDTGVVNLAGTD
NEVTTQGLDGLAERCAQYKKDGADFAKWRCVLKITSHTPSLLAMIENANVLARYASICQQ
AGIVPIVEPEVLPDGDHDLETAQRVTEQVLAFVYKALADHHIYLEGTLLKPNMVTAGQSC
PTKYTPQQVAHATVLALRRTVPAAVPGVTFLSGGQSEVDATVHLNAINCESLHRPWALTF
SYGRALQASVINAWKGKDDHITAGQQELLKRAKANSLASLGKYQGEEGGSAASQSLFVKD
HAY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccgagattcgttgatgccctgagcaaggaaaagaaagaggagttgtcaagaatagcg
aaagctattgtggctcctggtaaaggtatcctcgctgctgacgagagtacagcaaccatt
ggtaagagatttgcgaacattggtttggaaaacaacgaggataacaggcgcaaatatcgt
caacttctttttacatctggaaaagatctgcaccaatacatcagtggagttattatgttc
catgaaagtttctatcaaaaatctgactgtgggaaacctttaccagtccttctgaaagaa
caaggaattattcctggaatcaaagttgacactggtgtcgttaacttggccggcacagat
aatgaagttacaactcaaggtcttgatgggttggccgaaaggtgtgctcagtacaaaaag
gatggagctgattttgctaaatggagatgcgtgttgaaaataacgagccacacaccgtct
cttcttgcaatgattgagaatgcaaatgttcttgctcgttatgcttccatttgccaacaa
gctggaatcgttccgattgtggaacctgaagttcttcctgatggagatcatgatttggaa
actgctcaaagagttactgagcaagttcttgcttttgtttacaaagctttggctgaccac
cacatatacttagaaggtacacttctgaagcctaacatggtgacagctggccaatcatgc
cccacgaagtacactccccagcaagtggctcacgccactgtcctggctctcaggagaact
gtccctgcagctgtccctggagtaacatttttgtctggtggccagtcagaagtggatgcg
acagttcatttgaatgcgattaactgcgagtctttgcatcgaccatgggcactaactttc
agttatggaagagctcttcaagcttccgttatcaatgcttggaaaggtaaagatgatcac
attactgctggacagcaagagcttttgaaaagagcgaaggccaacagtctggcatctttg
ggcaaataccaaggtgaggaaggtggcagtgcagccagccagtcattgttcgttaaagat
catgcatattaa

DBGET integrated database retrieval system