KEGG   Helobdella robusta: HELRODRAFT_186113Help
Entry
HELRODRAFT_186113 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
hro  Helobdella robusta
Pathway
hro00020  Citrate cycle (TCA cycle)
hro00640  Propanoate metabolism
hro01100  Metabolic pathways
hro01200  Carbon metabolism
Module
hro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HELRODRAFT_186113
   00640 Propanoate metabolism
    HELRODRAFT_186113
Enzymes [BR:hro01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     HELRODRAFT_186113
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HELRODRAFT_186113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 20210435
NCBI-ProteinID: XP_009028567
JGI: Helro1_186113
UniProt: T1FNN8
Position
Unknown
AA seq 332 aa AA seqDB search
MASSRLFSTVFRLAPRYSNLGLRNLAYDATRANLMVSKSTKVICQGFTGKQGTFHSKQAI
DYGTLMVGGVSPGKGGQTHLGLPVFNSVKEAKEATGCDATVIYVPPPVAAKACMEAIDAE
IPLIVMITEGIPQHDMVRVKRRLMDQDKSRLVGPNCPGLIKPGECKIGIMPGHIHTAGKI
GVVSRSGTLTYEAVHQTTLTGLGQTLCVGIGGDPFNGTNFIDCLDVFLKDPKTEGIILIG
EIGGQAEEQASEFLKEFNSGPNRKPVVSFIAGLSAPPGRRMGHAGAIIAGGKGGAKEKIE
ALKSAGVEVTMSPAQLGSTMVKAFEKMGKSTS
NT seq 1001 nt NT seq  +upstreamnt  +downstreamnt
aaatggcgtcttcaaggttgttttcgacagttttccgattagcaccgaggtattcaaacc
ttgggctgagaaacctggcctatgatgccacaagagccaacttgatggtctcaaaaagca
ctaaagttatttgtcagggcttcactggaaaacaaggaaccttccatagcaagcaagcta
ttgattatgggactctcatggtgggaggagtctcccctggcaaaggtgggcaaacacacc
tcggcctacccgttttcaattctgttaaagaggccaaagaagcaacaggctgtgatgcca
cagtaatctatgtaccacctccagtggccgccaaggcctgcatggaggctattgatgccg
agattcccctaattgtcatgatcactgaaggaattccccaacatgacatggttcgagtga
agagaagactcatggatcaggataagtcaaggctcgttggtcctaactgtcctggactca
ttaagcctggtgaatgcaagattgggatcatgcccggacacatacacacagctggaaaaa
ttggtgttgtatcacgatcaggcactctaacctatgaagcagtgcaccagacaacgttga
cggggctagggcagaccctgtgtgtcggaattgggggcgaccctttcaacggaactaact
tcattgactgtctcgatgttttcctgaaagatcctaaaactgaaggtattattctaattg
gagaaatcggtggacaagcagaagaacaagcatcagagttcctcaaggaattcaattcgg
gccccaatagaaaaccagttgtgtccttcatagcaggcctgagtgcccctccaggtagga
gaatggggcacgctggggccatcattgcagggggtaagggtggggccaaggaaaaaattg
aggcccttaaaagtgccggtgttgaggtaactatgagtcccgcccagcttggttccacca
tggtgaaggcttttgagaagatggggaaatccaccagctaa

DBGET integrated database retrieval system