KEGG   Helobdella robusta: HELRODRAFT_186120Help
Entry
HELRODRAFT_186120 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
hro  Helobdella robusta
Pathway
hro00350  Tyrosine metabolism
hro00360  Phenylalanine metabolism
hro00380  Tryptophan metabolism
hro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    HELRODRAFT_186120
   00360 Phenylalanine metabolism
    HELRODRAFT_186120
   00380 Tryptophan metabolism
    HELRODRAFT_186120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hro04147]
    HELRODRAFT_186120
Enzymes [BR:hro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     HELRODRAFT_186120
    4.1.1.105  L-tryptophan decarboxylase
     HELRODRAFT_186120
Exosome [BR:hro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HELRODRAFT_186120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 SepSecS
Motif
Other DBs
NCBI-GeneID: 20210440
NCBI-ProteinID: XP_009028665
JGI: Helro1_186120
UniProt: T1FNP3
Position
Unknown
AA seq 472 aa AA seqDB search
MDANELNDKGKKMIDFVSSYWQTIRSRRALSVVEPGYLDTLLPNEAPLKAELWEDVLRDV
EQLIMPGITHWHSPHFHAYFPTGNSYPAICADILSDAIGCIGFSWISSPACTELEMKMMK
WLGKLINLPSQFYTPTNAGGVIQGTASEATLVSLLAARSKVIKDKNLSFQDINSTKMVVY
CSDQAHSSVERAVMLLLMQCRKILSDSEHRMNVKALSEAIKKDLEEGLTPTMCVATLGTT
STCSFDDLTEIGKICNEQNVWMHVDAAYAGASFICPEYQYLMEGVQYADTFNFNPHKWML
INFDCSALWFKDSSFMVEAFNVDPVYLQHVNQKVVLDYRHWQVPLGRRFRSLKLWFTMRL
LGVEQLQNHIRKSIKLAKDFEKLVCQNPDFEVVNNVILGLVCFRMKGDNSRSKKLLEKIT
ADGKIYLVPSEINGVYFIRFAICSWFTNEGDVNEAWSTIESLSKDISMQETF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaatgaattaaatgataaaggtaaaaagatgattgatttcgtctcatcgtac
tggcagaccatccgatctagacgtgcactttctgtcgtggagcccggctacttggataca
ttgctacccaatgaggctccgttaaaggctgaattatgggaggatgttttaagggatgtc
gaacagttaatcatgccagggatcactcactggcacagtccacacttccacgcttacttt
ccgacaggaaattcatatccggccatttgcgctgacatcctctccgacgccatcggctgc
atcggcttctcctggatctcaagtccagcctgcactgaactggagatgaaaatgatgaag
tggctcggtaagcttatcaaccttccaagtcaattctatactccaactaatgctggaggt
gttatacaaggaaccgcaagcgaggcaacattggtttctctattagccgcaagaagcaaa
gttatcaaagataagaatttgtcatttcaagatatcaactcaacaaaaatggttgtatat
tgctctgatcaggctcattcgtcagtcgagagggcagtgatgctgttgctgatgcagtgc
aggaaaattctttccgacagcgagcacaggatgaatgtgaaagcattgtcagaagcaata
aaaaaggatttagaagaaggactgaccccaaccatgtgtgtagctacattaggcacaact
tcaacatgttctttcgacgatttgacggaaatcggaaaaatttgtaatgaacaaaatgtt
tggatgcatgtggatgcagcatacgccggagcatcatttatatgtccagagtatcagtat
ttgatggaaggggtccagtacgccgacactttcaatttcaatccacataaatggatgctg
attaattttgattgttctgctctctggtttaaagatagttcattcatggtcgaagcgttc
aatgtggatccagtgtaccttcagcatgttaaccagaaagttgtacttgattacagacat
tggcaagtaccgttaggtagacgctttcgatctttaaaactttggtttacaatgaggttg
cttggagtggagcaacttcaaaaccacataagaaagagcataaaacttgccaaagatttt
gagaaattggtttgtcaaaatcctgattttgaagttgtcaataatgtcattttaggcctg
gtgtgttttagaatgaagggagacaattcaagatcgaaaaaattattagaaaaaataaca
gctgatggcaaaatatatcttgtaccatctgaaatcaatggtgtgtattttattcgattt
gctatttgctcctggttcactaacgaaggtgacgtcaacgaagcctggagcaccatagaa
agcctatcgaaagatatctctatgcaagaaacattttaa

DBGET integrated database retrieval system