KEGG   Helobdella robusta: HELRODRAFT_189284Help
Entry
HELRODRAFT_189284 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
hro  Helobdella robusta
Pathway
hro00071  Fatty acid degradation
hro00410  beta-Alanine metabolism
hro00592  alpha-Linolenic acid metabolism
hro00640  Propanoate metabolism
hro01040  Biosynthesis of unsaturated fatty acids
hro01100  Metabolic pathways
hro01212  Fatty acid metabolism
hro04146  Peroxisome
Module
hro_M00087  beta-Oxidation
hro_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HELRODRAFT_189284
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HELRODRAFT_189284
   00592 alpha-Linolenic acid metabolism
    HELRODRAFT_189284
   01040 Biosynthesis of unsaturated fatty acids
    HELRODRAFT_189284
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HELRODRAFT_189284
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    HELRODRAFT_189284
Enzymes [BR:hro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     HELRODRAFT_189284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 20211218
NCBI-ProteinID: XP_009025697
JGI: Helro1_189284
UniProt: T1FQX1
Position
Unknown
AA seq 688 aa AA seqDB search
MRTSAIDIEKKMNPLLESERKKNSFDVEEMTNVLDGGKIATERRRFIEKLAFTDVELWGP
DVRHMTREELFLEMTRRHVEAIKKCKKYNLTDAVDVTNFQRSVLNTYVTGLSLHQLVFVP
MLKLQSSEEQLRDWLPLVDSFKMIGCYAQTELGHGTYIRGIETSATYDPQTEEFILNSPS
ISSIKWWIGGLGKTANYALILAQLYTDDVNRGVHAFLVQIRDHNHMPMQGITLGDIGPKL
GLNSVDNGFLKLSHVRIPRNNMLMRYSKVLKDGTFVAPSNTRLLYGGMLQARIDLSDDAI
YVICLSITVVIRYSCVRLQCSMQNDQAECQIVSYQTQQNKLFPILSSAYAYRLAFPAINQ
WLTSATNMVDQGDVSDLGEAHALSSAMKVLLTTKSANFVETCRLSCGGHGYLDGSSLPVF
YRNIVATVTAEGEVSVLLLQTARFLVKTFVKLQQSSNMQLSPFTSYLLNQSRARNEPKKL
SSFNLESLVDAYQYRSYRLLSAVCERMNTLNAKERANKFYVWNACSVDLVHSSLAHIECV
IATVLVQQLSGNSNNNVMTSSSPSPSCLSCSSDVRRVLTNLCRLYLLNGLFESSADLLQF
SYLDPDQVTSMKLEMYNLYDVIRPDVVSLVDAMDFDDRHLKSVLGTYCGHVYEELYQWAQ
KSKLNETQVHPSFHKYVKPTRELFVSKM
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgaggacatctgctattgacattgagaaaaagatgaatccattgttggaatctgaaaga
aagaagaattcgtttgatgtagaggagatgacaaatgttctggatggagggaaaattgcc
actgagagaaggaggttcatagaaaagttagccttcactgacgttgagctctgggggcca
gacgttcgtcacatgaccagggaggagttatttttagaaatgacgaggaggcacgtagaa
gccataaagaaatgtaagaagtacaatctaactgatgctgtggatgttactaattttcaa
aggtcagtactaaacacctatgtgactggtttgtcactgcaccaattggttttcgttcca
atgttgaagttgcaatcaagcgaggaacagcttcgtgattggttaccactcgttgacagc
ttcaagatgattggttgctacgctcagacggaacttggtcatggcacatacatacgaggc
atagagacgagtgccacgtacgacccgcaaacagaggaattcatactcaactctccgtca
atatcttccattaagtggtggatcggtggattgggcaaaacggccaattatgccttaatc
ctggcacagttgtacacggacgatgtgaaccgcggtgtgcacgcattcctcgtacagatc
agagatcacaatcatatgcctatgcaaggaattacactaggtgatataggaccaaagtta
ggcttgaacagtgtcgataatggcttcctgaagttgagtcacgttcgcattccaagaaac
aacatgctcatgaggtattccaaggttctgaaggatggaaccttcgtggctccctcaaac
acacgtctgctgtacggaggaatgttgcaggctcgcatcgatctatccgatgacgccatc
tacgtcatctgcctctcaatcacagtggtcatcaggtacagctgcgtgagactgcagtgc
tccatgcagaatgaccaagccgaatgtcagatagtaagttatcagacccagcagaacaaa
ctgtttccaatcttatcatctgcttatgcgtaccgcctcgcctttcccgccataaaccag
tggctcacttctgctaccaatatggtggatcagggtgatgtttctgatcttggagaggca
cacgctctgtcgtctgccatgaaggttcttctaactaccaaatcggctaactttgtggag
acgtgcagactgtcgtgtggtgggcacggctacctggacggctcgagtcttcctgtcttc
tacagaaacatcgtcgccactgtaactgctgagggggaggtgtcggttctcttgctgcag
actgccaggtttcttgttaaaaccttcgtgaaactccaacaaagttcaaacatgcaactg
tcaccattcacgtcttacttactaaatcagtcacgtgctcggaacgagccgaaaaagtta
tcatcgtttaatttagagtctttggtggatgcttatcagtatagatcatacagattattg
tcagctgtttgtgaacgtatgaacacgttgaacgcgaaagaacgcgcaaacaagttctat
gtttggaacgcctgttcagtcgatcttgttcactcatctcttgcccacatagagtgtgtc
atagctacagtgttagttcaacaactaagcggcaacagcaacaacaatgtaatgacgtca
tcctcaccatcaccatcatgtttgtcatgttcatccgatgttcgtcgcgttctaaccaat
ctctgtcgtttgtacctgttgaacggtttgttcgaatcatcagctgatcttttgcagttc
agctacctggaccccgatcaggtgacgagcatgaagttggagatgtacaatttgtacgac
gtcattcgtcccgatgtcgtatcgctcgttgatgccatggattttgatgataggcatttg
aagagcgttctcggtacttactgcggtcacgtttacgaggaactttatcaatgggctcag
aaatctaaactcaacgaaactcaagtacatccatcgtttcacaagtacgtgaaaccaact
agagagctgtttgtttccaaaatgtga

DBGET integrated database retrieval system