KEGG   Helobdella robusta: HELRODRAFT_190723Help
Entry
HELRODRAFT_190723 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hro  Helobdella robusta
Pathway
hro00450  Selenocompound metabolism
hro00970  Aminoacyl-tRNA biosynthesis
hro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HELRODRAFT_190723
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HELRODRAFT_190723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hro01007]
    HELRODRAFT_190723
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hro03016]
    HELRODRAFT_190723
Enzymes [BR:hro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HELRODRAFT_190723
Amino acid related enzymes [BR:hro01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HELRODRAFT_190723
Transfer RNA biogenesis [BR:hro03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HELRODRAFT_190723
 Prokaryotic type
   Other AARSs
    HELRODRAFT_190723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 20211683
NCBI-ProteinID: XP_009013154
JGI: Helro1_190723
UniProt: T1FS86
Position
Unknown
AA seq 552 aa AA seqDB search
MVKRSLSLVFLRKFHKSSRGLKLPEKYFITTPIYYLNAEPHIGHLYSNVLADTVSRWYKF
LQVPTYFSTGTDEHGIKVFHAASKLNKPVQIFCDDLSHKFQNLFDKALIDYTTFVRTTSP
QHCRTVEHVWNKLESRGLIMEGSYEGWYCVSDEAFVSQDQVMQVQDEHDSNRMVMIENGN
AVEWVKEKNFMFPLSKFTDRLIQWLDTKVIQPDLYTLPLKQWIKSGLPDLSLSRQSDKCQ
WGIPVPGHPSHTIYVWLDAVVNYLTAANYPLEDDSIWPADCHVVGKDIIKFHAVYWPAFL
MALDLPLPKKILCHSHWQVNKEKMSKSRGNVVDPVDRLGRYSADGLRYYLMKDGSIQYDS
NYSDSRAVECINSDLVNTLGNLLSRSTGQNINPKQIFPSFDKDVFESLVTEADRKVLFQL
YQIADQVNIHYQNFAINRVIETVMSRLYDANALFQHYKPWSLNERECQCILHISLEAVRV
ACLALQPIIPNLSDKALKRLGIEDNERSWSDIIHPINMQGFHGSRSLGRHTGPLLERLKT
CGAENVNKRRGP
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaagaagtttgtcgctcgtgtttttgagaaagttccacaaatcgtcgcgtgga
ttaaaattgccagagaaatatttcatcacgactccgatttattatttaaatgccgaacct
cacattggacatttgtattcaaatgttttggcagacacagtcagcagatggtacaaattt
cttcaagtcccaacttatttctctacaggaactgatgaacatggaattaaggttttccat
gcagcttcaaagctgaacaaacctgtccaaattttttgtgacgatctgtctcacaagttt
cagaatctttttgacaaagctctgattgattacacaacctttgtgagaacgaccagtccc
cagcactgcagaacggttgaacatgtttggaacaagctggagagtagaggattgattatg
gaggggtcatatgaaggatggtactgtgtgtcagatgaggcatttgtcagtcaggatcaa
gtcatgcaggttcaggatgaacatgactccaacagaatggtgatgatagagaatggaaat
gcagtggagtgggtgaaggagaagaatttcatgtttccactttccaagtttacagatcga
cttattcaatggcttgacacaaaagttattcagcccgacttgtacacccttccactcaaa
caatggattaaaagtggacttccggatttgtccctgtctcgacagagtgacaaatgtcaa
tggggcattcctgtccccggtcatccaagtcacacgatatacgtgtggctggatgctgtg
gtaaattatttaacagcagccaattatccactggaagatgatagcatctggcctgctgac
tgccatgttgtcggcaaggatattatcaagttccatgcggtgtactggcctgcattcctc
atggcacttgatctgcctctccccaaaaagattctctgccattcacactggcaggtcaac
aaagaaaagatgtcaaaaagccgtggtaacgtggtagatcccgtggaccgtctggggagg
tactcagcagatggattgaggtactatctcatgaaggatggcagcattcaatatgattct
aactatagtgacagcagagctgtggagtgcatcaactctgatttggtgaatacattgggc
aatttattgagcagatcaacaggtcagaacatcaatcctaaacaaatatttccttcattt
gacaaggacgtcttcgaatcacttgtcactgaagcagataggaaggttctcttccaactt
tatcaaatcgcagatcaggtgaacattcattatcaaaactttgccataaatcgagttatc
gaaacagtcatgtcccgattgtatgatgcaaatgctctcttccagcactacaagccatgg
tcgctaaacgaacgggagtgtcaatgcatacttcacatttctctcgaagctgtcagagtt
gcgtgtctagctcttcaacccattattcccaatttgtctgacaaagcgttgaaaaggtta
ggaattgaggacaatgaaagatcgtggtctgacataattcatccaatcaacatgcaaggt
ttccatgggtcaaggtcgctgggtcggcacacgggacctctgctcgagaggttgaagact
tgtggtgctgaaaatgttaataaaagacgtggaccctga

DBGET integrated database retrieval system