KEGG   Helobdella robusta: HELRODRAFT_192726Help
Entry
HELRODRAFT_192726 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K16944  septin 7
Organism
hro  Helobdella robusta
Brite
KEGG Orthology (KO) [BR:hro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hro04131]
    HELRODRAFT_192726
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hro04812]
    HELRODRAFT_192726
   04147 Exosome [BR:hro04147]
    HELRODRAFT_192726
Membrane trafficking [BR:hro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    HELRODRAFT_192726
Cytoskeleton proteins [BR:hro04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     HELRODRAFT_192726
Exosome [BR:hro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HELRODRAFT_192726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Ras Roc Fez1 GTP_EFTU AAA_22 AAA_7 Pox_A32 AAA_16 ABC_tran AAA_29 Dynamin_N TPR_MLP1_2 AAA_24 Angiomotin_C
Motif
Other DBs
NCBI-GeneID: 20212380
NCBI-ProteinID: XP_009021854
JGI: Helro1_192726
UniProt: T1FU84
Position
Unknown
AA seq 502 aa AA seqDB search
MSRRARDAFLASPAVGNPSVKPEHAPREREIEKDLTKQPLSTLNNTSQYLSNSHSSNTIK
STTSSGGFSLRDGTGDSGGCHEVGYVRLPNQIYRKSVKRGFDFTLMVVGESGLGKSTLIN
SLFLTDIYSAENRMPVFKTKKTLQVETTQVSLSEKGVKLKLTIVDTPGFGDFIDNTNCWE
PIINYIDSRYEEYLNAESRVNRVQILDSRVHCCLYFISPNGHGLKALDIEFMKRLHDKVN
IIPLIAKADSMTKEEVTEFKKIILQEIAENKINIYDFPVNSNINSISSDDDERMLKLYKD
RVPFAVVGSNTLIETSQGRKVRGRMYPWGAVEVEKLEHNDFTALKNMLIGMHMQDLKDVT
NNVHYENFRFNRLACLDGPSNRNNNNKAVVHSDKYVVVVWSPMLQIEEEKREHVQKMKKM
ELEMEQVFQMKVKEKVQKLHDSEIDLHRRAEQMKKNLEQQEKELEERIQAFEAERDAWEE
QNRSLVILDDSASKKDKKKSLF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgacgagcccgtgacgcatttctggcctccccggcagtcggtaatccgtctgtc
aaaccggagcacgcccccagagaacgagagatcgagaaagatctgacgaagcaaccgcta
tcaactctcaacaacaccagtcagtatctttcaaatagtcattcatcaaatacaataaag
agcacaacatcctctgggggcttttctttgagggatggaacaggggatagtggtggttgc
catgaggttggttacgtccggctgcctaatcagatttacaggaagtctgtaaaaagagga
tttgatttcactttgatggttgtaggtgagtctggcctagggaaatccacattgataaat
tccttgttcctaactgatatatacagcgctgaaaatcgtatgccggtttttaaaactaaa
aagactcttcaagttgaaacaactcaagtctctttaagcgaaaaaggcgtcaagttgaag
ctgaccatcgtcgacactccaggctttggagattttatcgataacactaactgctgggag
ccgataataaattacatagacagcagatacgaagaatatttgaatgcagagtctcgagtt
aatagggtacagattctggattctagggtccattgctgtctctactttatatcacccaat
ggacatgggctgaaagcgttggacattgagtttatgaagagactacacgacaaggttaac
attattcctctgattgccaaagctgactcgatgactaaggaagaagttactgaattcaag
aaaattattttacaagagatagcagagaacaagataaacatttacgatttcccagttaac
tccaacattaactccatcagttcagatgacgatgagagaatgctcaagttatacaaggat
agagtgccatttgctgtagttgggagtaacaccctgattgaaacttcccagggtcgaaag
gtcagaggtcgtatgtacccgtggggggctgtcgaagttgagaagttggagcataatgat
ttcacggctctgaaaaacatgcttatagggatgcatatgcaagacttaaaagacgttacg
aataacgttcactatgagaacttcagattcaacagactggcctgtctcgatggtccctcc
aataggaataacaataataaagctgttgttcattctgataagtatgtcgttgttgtttgg
agtccgatgttacagatagaggaggagaagagagagcacgtgcagaagatgaagaagatg
gagctggagatggaacaagttttccagatgaaggtcaaggagaaagttcagaaactgcat
gactctgaaatcgatctgcatagacgagctgagcagatgaaaaaaaacctggagcagcaa
gaaaaggaactggaggagaggatccaggcttttgaggcagagcgggacgcctgggaagaa
caaaataggagtctggtgatcctggatgactcggcatcaaagaaagataaaaagaagtca
ttattctga

DBGET integrated database retrieval system