KEGG   Helobdella robusta: HELRODRAFT_194833Help
Entry
HELRODRAFT_194833 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
hro  Helobdella robusta
Brite
KEGG Orthology (KO) [BR:hro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hro01001]
    HELRODRAFT_194833
Enzymes [BR:hro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     HELRODRAFT_194833
Protein kinases [BR:hro01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   HELRODRAFT_194833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like YrbL-PhoP_reg Kdo Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 20213163
NCBI-ProteinID: XP_009010535
JGI: Helro1_194833
UniProt: T1FWG8
Position
Unknown
AA seq 451 aa AA seqDB search
MKNNKGEDAKERVESGGGGRLDFWLKESIKDVKFSDEYVIDRELGRGATSIVYRCRCRRT
SKEWAVKMINKKVERRIVATEIGVLLKLNHPNIFNFQFDSKTSPEDNVECVGIKCQIRLK
EVYESTAVIHMILELVTGGELFDRIVSCGFYSEKEAIKCVSQMLEAVQYLHNNDIIHRDL
KPENLLYEDESDDAKLKIADFGLSKITEHNIQMQTICGTPGYCAPEVLKGHRYDSSVDLW
SIGVITYILLCGYEPFYGNTENETFKKILLCQYVFDSPWWDDVTDVAKDFVSRLLLANPS
ERMTTSQALQHPWLTGKDKVTFKEHLPNVKDKLKDFNAKRKLKAATDVLMALKFRHPHPP
NDDVIPSDVHGEDKCVISPAEKEDKDQNEDAGDGDKIDGATGDKNAESCNGDEEEDGGDV
DDGGGCCCASTSNQQPRATSPFSAAAKCSSK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataataagggggaggatgctaaggagagggtagaatcaggagggggtggtagg
ttggacttctggctgaaagaaagcatcaaagacgtcaaattttctgacgaatacgtcatc
gacagggagttaggcagaggagccacgtccatagtttacagatgcaggtgcaggcgaact
agcaaggagtgggcggtgaagatgatcaacaagaaggtcgagagaaggattgtggccact
gaaatcggtgtcctactcaaactgaatcatcctaatatcttcaacttccagtttgattca
aaaacttcacccgaagataatgttgaatgtgttggaatcaaatgtcagattcgtctgaag
gaggtttacgagagcactgcagtcatccacatgattctcgagctggtcaccgggggagag
ctgttcgatagaatcgtctcgtgtggcttctacagtgagaaggaggctatcaagtgcgtc
agtcaaatgctggaggctgttcagtatctccataataacgacatcatccatagagacctc
aaaccggaaaacctcctctatgaagatgagtctgatgatgctaagctaaaaatagctgac
ttcggcctatcgaagataacggagcataacattcaaatgcagacgatatgtggcacgcct
ggctattgtgcaccggaagtactgaagggacatcgatatgactcgtccgtggacctctgg
agcatcggcgtcatcacgtacatacttttgtgcgggtatgaacccttctacggcaacaca
gagaatgaaactttcaaaaaaattctactctgccagtacgtctttgattcgccatggtgg
gatgacgtcacggatgttgccaaggactttgtgtctagactcttattagcaaatcccagc
gaacgtatgactaccagccaagcactgcaacatccatggctcactggcaaggacaaggtg
acgttcaaagagcacctgccaaatgtcaaggacaaactgaaggacttcaacgcaaaaaga
aaactcaaagctgccaccgatgtactgatggccctgaagttccgccatcctcatccccca
aacgatgacgtcattcctagtgatgtgcacggagaagataaatgtgttattagtcctgct
gaaaaagaggacaaagatcaaaatgaagatgctggtgacggtgataaaattgatggagct
actggggataaaaacgcagaaagttgtaacggggatgaagaagaagatggtggggatgtt
gatgatgggggaggttgttgttgtgcgagtacctccaatcaacaaccgagagcaacatcc
ccgttctcagctgctgccaaatgttcttcgaaataa

DBGET integrated database retrieval system