KEGG   Helobdella robusta: HELRODRAFT_85035
Entry
HELRODRAFT_85035  CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
hro  Helobdella robusta
Brite
KEGG Orthology (KO) [BR:hro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hro01002]
    HELRODRAFT_85035
Enzymes [BR:hro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     HELRODRAFT_85035
Peptidases and inhibitors [BR:hro01002]
 Metallo peptidases
  Family M1
   HELRODRAFT_85035
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N IcmF-related
Other DBs
NCBI-GeneID: 20216413
NCBI-ProteinID: XP_009023892
JGI: Helro1_85035
UniProt: T1G5R6
Position
Unknown
AA seq 896 aa
MSGNETCWKDFRLPKDLVPQSYEILIHPDFERFDFRGWSCVEVVVKTSVDYIVMHTKDLN
ITINDIRYTIYSEKIEIEKHVIVEEREQLFIKLSSHLLKNSHILINISFHGILKNNGEGF
FLNFYKTKNKTFRYLAATQMQATYARTVFPCFDEPQMKAEFKMSIIRPKHYISLFNTEKI
CEKEVSSIETMDIYHSSPKMSTYLVAVVVSDYSSKAHLTKSGTAVAIYAPPDSIDDVDFA
LDCAVKLLDYYEVYFGIKYPLPKLDIAVINELSIGAMENWGLVLFIPNFLFYNADDNTET
DKTMVAIVLAHELAHQWFGNLVTMEWWDDLWLNEGFATYVQYIGAKHIFPDRPLEENFSS
ETMVPAMISDSSDTSHAISISVEDPKKISEIFDAISYDKGASIIKMLESVIGPEKFKKAI
KNYLTSHKFKNAKSSDLWESFSKEYRSLKVKEMMDTWTLQMGFPVVTIRRNGRELSLHQE
RYLVIDHSKISNFTVEPAKFNYTWNIPLTYFTNRNLTHHSFYQFKQKSAKVPTLLPQNVT
WLKANSKMSGFYRVNYDDNGWRDLIKQLKLNHSVFTPIDRGNLLSDAFFLVRSGHVKLEV
ALELSLYMEKEESNNPWSMMLNSVRPIYNLLSSNFHYSKFKRYMQKIMTPRLKKLGFNND
GNGNLKATKIGMMTFALELGFQEYVDWAKNSFKKIVNGTKLAQLTPDQESMVYKFAVRYG
GDEEWNYIMDLALHPNTSIFQKNSLLEALAYTNDDLKFRKFLPLNETAVEPEGYASILYA
IRFNPAHGETQWSFLRANWNKTSEIFKHSSTKLRELLSELTAQLSTETQYEQLKTFLMTN
RANDSERLNYELLDKVRMNIDWKKKFEGELVQWLEKHFYSSADCDTSDGLKVSTNI
NT seq 2691 nt   +upstreamnt  +downstreamnt
atgagtgggaatgaaacatgctggaaagattttagactgccgaaggacttggtgcctcaa
tcttatgagattcttattcatcctgactttgaacgatttgattttcgtggctggtcgtgt
gtggaggtggttgtcaaaaccagcgtcgactacattgtcatgcataccaaagatctcaat
atcaccataaatgatatacgctatacaatttattcagaaaagatagaaattgaaaaacac
gtgattgttgaggaacgggagcaactgttcattaaactgtcctctcatctcctgaaaaat
tcccacatcctcatcaacatatccttccatgggatactcaaaaataacggggaaggtttt
tttctaaacttttacaagaccaaaaataaaacattcagatatttagctgcaacgcaaatg
caagcaacttacgccagaactgtctttccctgctttgacgagccacagatgaaagcagag
ttcaagatgagcatcatcagaccaaagcattacatttcattgttcaacactgaaaaaata
tgcgaaaaagaagtttcctcgatcgaaacgatggacatctaccacagctctccgaagatg
agcacctacctggtggcagttgtcgtgtcagactattcgtcgaaagctcatctcactaag
agcgggactgctgttgcaatatatgccccacctgattctatcgacgatgtcgacttcgcc
cttgactgtgcagtgaagcttcttgactactacgaagtctattttggaatcaagtatcct
ctccccaaacttgacattgcagtcataaatgaactgtctattggtgcaatggaaaactgg
ggtttagtgttatttataccaaattttctgttttataacgctgatgacaacacggagact
gataagaccatggtggcaattgtgttggctcacgagttggctcatcagtggtttggcaac
ctggtaaccatggagtggtgggatgacttgtggttgaatgaagggttcgccacatacgta
caatatattggagccaagcacatttttccggaccgacctttagaagagaatttttcatcg
gagacaatggtgcctgccatgatatcagattcgtcagacacttcgcatgccatttcaatt
tccgttgaagaccccaaaaaaatttctgaaatatttgatgccatatcatatgataaaggt
gcctcaatcattaaaatgctggaaagtgtgatcggacctgaaaagttcaaaaaagcaata
aagaactatttaacctcacacaagttcaagaatgcaaaaagtagtgatttgtgggaatcg
ttctctaaagagtatcgtagcttgaaagtgaaagaaatgatggacacgtggactctgcag
atggggttcccagtggtcacaatacgcaggaatggtcgggagttgtcactccaccaagag
agataccttgtcattgaccactcgaagatcagcaattttacagtagaacctgcgaaattt
aattacacgtggaatatcccacttacatacttcaccaatagaaatttgacgcatcattcc
ttttaccaattcaaacaaaaatcagctaaagtccctacacttctgccgcagaatgttact
tggctgaaagcaaattcgaaaatgtcaggtttctaccgggtgaactacgacgacaatggc
tggcgtgacctcatcaagcaactcaagttgaaccattcggttttcacacctatagacaga
ggaaacttactgagtgatgcattctttctagtcaggtcgggccacgtaaaactggaggtg
gctcttgaactttctctgtacatggagaaagaagaaagtaacaacccatggtcgatgatg
ctaaacagcgtcagaccgatctacaacctcctctcatccaactttcattacagcaaattt
aagaggtatatgcaaaaaataatgacgcctaggctgaagaaacttggtttcaacaacgat
ggaaatggcaatttgaaagccacaaagattggaatgatgacctttgcacttgaacttggg
ttccaggagtacgtggattgggccaagaactcattcaagaagatcgtcaatggaacgaag
ttagcgcaactaacacccgaccaagagtccatggtatacaagtttgccgtgagatatggc
ggtgacgaggaatggaactatatcatggatttggccttgcaccccaacacgtcgatattc
cagaaaaatagtttgctggaagcgcttgcctacactaacgatgacctgaaatttagaaag
ttcttgcctttaaacgaaacggcggtggagccagaaggatatgcaagcattctttatgct
atcagatttaatccagctcatggtgagactcaatggagtttcctgagagcaaactggaat
aagacatctgaaattttcaagcattcatctacgaagcttagggaattgttatctgaatta
acagcacaactttcaacggaaacacagtatgaacaattgaagaccttcctgatgacgaac
agggcaaacgacagtgaacggctgaactatgaactcttggacaaagttcgcatgaacatt
gattggaagaagaaatttgaaggagaacttgttcaatggctggaaaagcacttttattct
tcagccgattgtgacacttcagatggattaaaagtcagcaccaacatttga

DBGET integrated database retrieval system