KEGG   Helobdella robusta: HELRODRAFT_85047Help
Entry
HELRODRAFT_85047  CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
hro  Helobdella robusta
Pathway
hro00600  Sphingolipid metabolism
hro01100  Metabolic pathways
hro04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    HELRODRAFT_85047
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    HELRODRAFT_85047
Enzymes [BR:hro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     HELRODRAFT_85047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 20216418
NCBI-ProteinID: XP_009023897
JGI: Helro1_85047
UniProt: T1G5S1
Position
Unknown
AA seq 336 aa AA seqDB search
ATSKLLVNYPEQQRNEILDYLFKPYYGASLQILKVEIGGDSQSTDGSESSHMHAEDDEDY
NRGYQWGIMKEAKKRNPSIKLYGLPWVFPGWLADDRKLNPYFNISSTVRYVVNWIKGAKV
HHDLDINYIGLLRRTLNDNGLNDVKLVAPDAMNWSYVDELISDEELRSAVDIIGQHYPGG
YSPDIARSLSKKLWASEDYSTVDDVIGSACWARVLSEGVVFGYLTSFIAWNMVSSYYEGL
PYSRSSLMTANQPWSGHYEVNGPIFITAHHTHFYDVGWVYSPHGEGVGVLKGGGTFVTLT
NPVSRDVTIVVETIVSFQNAFTIIRCFIKDCYCYNL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gccacttcaaaattgctagtgaactaccctgagcaacagagaaatgaaattttggattat
ctttttaagccatattatggcgcctcattgcagatcttgaaagtcgaaataggaggtgat
tcgcagagcacagatggctcagaatcgtcgcacatgcacgcagaagatgacgaggattac
aacagaggataccagtgggggatcatgaaagaagcaaagaaaagaaacccgtctataaag
ttgtatggtcttccatgggtgttccctggttggttggccgatgacagaaagctcaatcca
tacttcaacatttcatccactgtcagatacgttgtgaactggataaagggagcaaaggtt
catcacgatctagatatcaattatatcgggttgttgagacgcacgctgaacgataatggc
ttgaatgacgtgaagttggttgctcccgacgccatgaattggtcgtatgtggatgagctc
ataagtgacgaggaactcaggagtgctgtcgatataattgggcaacactacccaggtggt
tacagtccagatatcgctcgatcgttatcaaagaagttgtgggcatccgaagattacagc
acggttgatgacgtcattggatctgcttgctgggcaagggtcctcagtgaaggggttgta
tttggatatttgactagcttcatagcatggaacatggtgtccagttattatgaaggtttg
ccttactccagaagtagcttaatgacggccaaccaaccgtggagtggtcactatgaagtc
aatggaccaatctttattactgctcatcacacgcatttttatgatgttgggtgggtatac
tctcctcacggagagggagtgggcgtgttgaaaggtggcggtacatttgtaactctcacc
aatccagtatcacgtgacgtcacaattgttgtcgaaaccattgtgagttttcaaaatgca
tttactataataagatgtttcatcaaggattgttattgttataatttatga

DBGET integrated database retrieval system