KEGG   Helobdella robusta: HELRODRAFT_93050Help
Entry
HELRODRAFT_93050  CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
hro  Helobdella robusta
Brite
KEGG Orthology (KO) [BR:hro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hro01001]
    HELRODRAFT_93050
Enzymes [BR:hro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     HELRODRAFT_93050
Protein kinases [BR:hro01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   HELRODRAFT_93050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo FTA2 DUF1133
Motif
Other DBs
NCBI-GeneID: 20217468
NCBI-ProteinID: XP_009021381
JGI: Helro1_93050
UniProt: T1G8S1
Position
Unknown
AA seq 210 aa AA seqDB search
ILKQVRHPHIVSMHGLYESKDAVYIVTDLAGGGELFQQLLKKGNYTEKDAANLIRQMLEG
LSYLHKCDIVHRDMKPENAKQLLFQTTDENASLMITDFGLSKILKNHDDVLTTACGTPGY
VAPEVLLQTGYGKPVDLWSVGVITFTLLSGYTPFWGDDQASLFESIIAGKYEFDEDYWSD
ISDPAKDLINKLLTFEPSKRITADEALLHP
NT seq 631 nt NT seq  +upstreamnt  +downstreamnt
atcctcaagcaagtccgtcatcctcatattgtatcaatgcacggcctgtatgaatcaaaa
gatgcagtttacattgtaactgatctggctggcggcggtgagttattccaacaattgctg
aaaaaaggaaattataccgaaaaggatgctgcaaatctgatcagacagatgctcgaagga
ctttcttacctacacaagtgcgatattgtacacagagatatgaagcccgaaaatgcaaaa
cagcttttgttccagacaaccgatgagaatgccagtctaatgatcacagactttggtctt
tcaaaaatacttaagaatcacgacgacgtattaacaactgcctgtggtacacctggatat
gttgctcctgaagtccttcttcagactggctatggaaaaccagttgatttgtggagtgta
ggcgtaattacattcactttattaagtggctacacacctttctggggtgatgatcaagca
tctctatttgagtctatcattgcagggaaatatgaatttgatgaagactactggtctgat
atttccgatccagcaaaggaccttattaacaagcttctcacatttgagccaagtaagcgt
atcacagcagatgaagcactgctccacccat

DBGET integrated database retrieval system