KEGG   Helobdella robusta: HELRODRAFT_98414Help
Entry
HELRODRAFT_98414  CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
hro  Helobdella robusta
Brite
KEGG Orthology (KO) [BR:hro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hro03041]
    HELRODRAFT_98414
   03009 Ribosome biogenesis [BR:hro03009]
    HELRODRAFT_98414
Enzymes [BR:hro01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     HELRODRAFT_98414
Spliceosome [BR:hro03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    HELRODRAFT_98414
Ribosome biogenesis [BR:hro03009]
 Eukaryotic type
  90S particles
   Helicases
    HELRODRAFT_98414
  Pre-60S particles
    HELRODRAFT_98414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII SecA_DEAD AAA_30 AAA_22
Motif
Other DBs
NCBI-GeneID: 20217771
NCBI-ProteinID: XP_009014272
JGI: Helro1_98414
UniProt: T1G9M5
Position
Unknown
AA seq 521 aa AA seqDB search
MTEEADNVHAEGEPNKEDKPMESLAETFKQNKSFSVLNGFVSEKSLKAVEKLGFKEMTQI
QAQCIPHLLEGRDLLGAAKTGSGKTLAFLIPVIERINKLGFKPRSGTGAIIISPTRELSM
QTFKVLEELLQFHGHTFGLVMGGTNRQQEAKKLGKGINILVATPGRLLDHLQNTPEFIFS
NLKVLVIDEADRILQDGFEEEMRQIIKILPRKRQTMLFSATQTKKTEDLVKVSLKKDVVY
VGVDDEEKKATVEGLEQGYVVCPPEKRFLVLFTFLKKYRNKKVMVFFSSCMAVKYFHDLL
NYIDLPVMCIHGQQKQAKRTETFFKFCNDSESILLCTDVAARGLDIPAVDWIVQYDPPDD
PNEYIHRVGRTARGAGGSGHALLFLTSEEILFLDYLKEAKVPLSEYEMKWNKVSNIQSQL
EKLLGKNYYLHQAAQEGYKAFIRSYVSHSLKTIFDVHKLDLQKVAQSFGLLVPPHVPLKS
NSLKRKNSNFKYEGGIDKKRKLEKNKFYKKVSSRSNNKSKK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaagctgataatgtacatgcagaaggtgaaccaaataaagaagataagcca
atggaaagtcttgctgaaacgtttaaacaaaacaaatctttctcagtgctgaatggattt
gtttctgagaaatcgttgaaggcggttgagaaactcggcttcaaagagatgactcagatt
caagcacaatgtatcccacatttgctggagggcagagatttgctgggtgcagccaaaaca
ggtagtggcaagacgttggcattcctcattccggtaattgagcgcatcaataaacttggg
ttcaaaccaagaagtggcactggagcaataataatttcaccaacgagggaactttccatg
cagacgttcaaagttctggaggagttgctccaattccatggccacacatttggcctggtc
atgggtggcacaaatcgacagcaggaggcaaaaaagcttgggaaaggaatcaatattctt
gtggccacacccggaaggctcttggatcatttacaaaacacgccggagttcatattcagc
aaccttaaagttcttgtaattgatgaggcggacagaattcttcaagatggtttcgaagaa
gaaatgaggcaaatcatcaaaattttaccaagaaaaagacaaaccatgttgttttctgcc
acacagacaaagaaaactgaagatctggtgaaggtgtcgttaaaaaaagacgtggtgtat
gttggtgtcgacgatgaagagaagaaggccacagttgaaggcctggaacagggttatgtt
gtatgtccgccagaaaaaagattcttggtgctgttcacgtttttgaaaaagtacagaaat
aaaaaagttatggtgtttttcagctcctgcatggctgtcaagtatttccatgatcttctc
aattacattgatttgcccgtcatgtgcatacatggacagcaaaagcaagcaaagaggact
gaaacgttctttaaattttgcaacgattcagaatccatattgctgtgcaccgatgtggca
gcacgagggttggacattcccgccgtggactggattgttcagtacgatcctccagatgat
cccaatgagtacatacatcgagttgggagaacggctcggggtgcgggagggtcgggccac
gccctccttttcctcacgtcagaggaaattttatttctcgactacttgaaagaagccaaa
gtaccattaagtgaatatgaaatgaaatggaataaagtttctaatattcaatcacagttg
gagaagctgctgggtaagaattattacctgcaccaggctgcccaagaaggttacaaggca
ttcattcgttcctatgtctctcactcccttaagacaatatttgatgtccataaattggac
ctgcaaaaagttgctcagtcatttggtcttctcgttcctccacatgtcccactcaagtca
aatagccttaaacggaagaattcgaacttcaagtacgaagggggaattgacaaaaagaga
aaacttgaaaagaacaaattttataaaaaagtttcatctcgctcaaacaataaatcaaaa
aaatga

DBGET integrated database retrieval system