KEGG   Halovivax ruber: Halru_0738Help
Entry
Halru_0738        CDS       T02402                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hru  Halovivax ruber
Pathway
hru00260  Glycine, serine and threonine metabolism
hru00750  Vitamin B6 metabolism
hru01100  Metabolic pathways
hru01110  Biosynthesis of secondary metabolites
hru01120  Microbial metabolism in diverse environments
hru01230  Biosynthesis of amino acids
Module
hru_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halru_0738
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Halru_0738
Enzymes [BR:hru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Halru_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP OrfB_Zn_ribbon
Motif
Other DBs
NCBI-ProteinID: AGB15365
UniProt: L0I739
Position
complement(773820..775013)
Genome map
AA seq 397 aa AA seqDB search
METTEAFTGLECHDCDRSYAPEAGTHRCADCGGILDPTYDYDAIDVTRESLADRPFDSLW
RYAELLPFERDVAVSMDEGATPAVECETLADELGVGEVLIKDEGRNPTGTFKDRGASMAV
TAAVAHGATDVVLPSAGNAGQAASAYAARAGLDAHVFLPSRSSFTTKAMVNVHGGDLTVS
GGRIGDAGAAATDAMAEHDDWYSLSSFVTPYRHEGKKTMLYELVEQRDWQVPDAIVYPTG
GGVGLVGMYKAAREWRELGLIDEIPAFYAAQASGCAPIVEAFDAGRDEHEPIENPDTICG
GIEIPDPGASRWILDALRESGGGAVATDDHEILDAAVAVAQNEGLEMAPTCAAAASGAWA
LAERGEFDADDTVAIVNTGAGNKNADVLRSHLMGQGI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaccgaggcgttcaccggactcgagtgccatgactgtgatcggtcgtacgct
ccggaggcgggaacgcaccgctgtgcggactgcggcgggatcctggatccgacctacgac
tacgacgcgatcgacgtcacgcgagaatcgttggctgatcgcccgttcgactcgctgtgg
cgctacgccgaactcctgccgttcgagcgtgacgtagccgtgtcgatggacgagggtgcg
acaccggcggtcgagtgcgagacgctcgcggacgaactcggcgtcggggaggtgctgata
aaggacgaggggcgaaacccgactggcacgttcaaggatcggggcgcctcgatggccgtg
acggcggcggtggcccacggggcgaccgacgtcgtccttccgtcggccgggaacgcgggg
caagccgcctcggcgtacgccgctcgcgcgggcctggacgcgcacgtcttcctcccgtcg
cgctcgagtttcacgacgaaggcgatggtgaacgtccacggcggtgatctgacggtcagt
ggtggccgcatcggcgacgccggcgctgcagcgacggacgcgatggccgagcacgacgac
tggtattcgctgtcgtcgttcgtcacaccctatcgccacgagggaaagaagaccatgctc
tacgagctggtcgaacagcgcgactggcaggtgccggatgcgatcgtctatccgaccggt
ggcggcgtgggcctcgtcggcatgtacaaggcggcccgcgagtggcgcgaactcggcctg
atcgacgagatacccgcgttctacgccgcgcaggcgtcgggctgtgcgccgatcgtcgag
gcgttcgacgccggccgagacgaacacgagccgatcgaaaatccggataccatctgcggc
ggtatcgaaattccggatccgggtgcgagccggtggattctggacgcccttcgcgagagc
ggaggcggagccgtcgccaccgacgaccacgagatcttagacgccgcggttgccgtcgcc
cagaacgagggtctcgagatggcgccaacctgtgctgccgcggcgagcggggcgtgggcc
ctcgccgaacggggtgagttcgacgccgacgacacggttgccatcgtcaacaccggcgcc
gggaacaagaacgccgacgtcctgcgcagtcacctgatgggacagggaatctag

DBGET integrated database retrieval system