KEGG   Halovivax ruber: Halru_1015Help
Entry
Halru_1015        CDS       T02402                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K12454  CDP-paratose 2-epimerase [EC:5.1.3.10]
Organism
hru  Halovivax ruber
Pathway
hru00520  Amino sugar and nucleotide sugar metabolism
hru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Halru_1015
Enzymes [BR:hru01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.10  CDP-paratose 2-epimerase
     Halru_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: AGB15634
UniProt: L0IA74
Position
1049813..1050862
Genome map
AA seq 349 aa AA seqDB search
MTETILVTGGAGLIGSMCCEELIENGYNVVSVDNYGRGDIFGDEGNTESNVTEYLDDDRI
DHHQMDIRDDDFDEIVASVDGIIHTAAQPSHPRSIEIPYEDFDINVRGTLKLLEAVRTQN
PDIPLVFTSTNKVYGEMPNYFSYEKVGDRFEPVDDTLWNGFDESLRIDQNKHTPFGVSKA
SADLYVQEYARMYDIKAGIFRLGCVTGGAAHAVELHNWEPYFVKLALTGEELSIYGYEGY
QVRDVIHAKDLANLFRRYLESPSPGQVYNVGGGRKNSISLRESFDLIEEVTGNTLEYSHA
EQREADHQWWISDLSKVHRHYPDWEITHGLREIFEDITKALRKNLDEVS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacggagacaatactggtaactggtggagcaggactgattggctcgatgtgctgcgag
gaactcatcgagaacggttataatgttgtaagcgtagataattatggacgcggggatatc
ttcggggatgaagggaatactgagtccaatgtaaccgagtatctcgatgatgatcggatt
gaccatcatcaaatggatatccgtgatgacgactttgacgagattgttgccagtgttgat
gggatcattcacacagctgcccaaccgtcccatccacgatcaatcgaaatcccgtacgaa
gatttcgatatcaacgtacgcggcacactgaagctactcgaagcagttcggacacagaac
ccagacattccactagtgttcacatcgacgaacaaggtatacggcgaaatgccgaactac
ttttcatacgagaaagtcggtgaccggtttgagccagttgacgatacactatggaacgga
ttcgatgaatcgttgcgaatcgaccaaaacaaacacactccgtttggagtttcgaaggcc
tctgcggatctgtacgttcaagagtacgcgcgaatgtacgatatcaaagcaggaatattc
cgactgggatgtgttactgggggcgctgcccacgccgtcgaacttcacaactgggaaccg
tatttcgtaaagcttgctctcacgggagaggaactgagtatatacgggtacgaggggtat
caggtccgggatgtgattcacgccaaggatcttgcgaatctctttcgccggtacttggag
tcaccttcaccaggtcaggtgtataatgttggcggcggacgcaagaactcaatctcactg
cgggaatcattcgacctaatcgaagaggttactggaaatacactcgagtattcacacgct
gaacagcgtgaagccgaccaccagtggtggatttcagacctctcaaaagttcatagacat
tatcctgattgggaaattacgcacggactgcgcgagatcttcgaggatatcaccaaggct
ctcagaaaaaacctcgacgaagtatcgtga

DBGET integrated database retrieval system