KEGG   Halovivax ruber: Halru_1449Help
Entry
Halru_1449        CDS       T02402                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hru  Halovivax ruber
Pathway
hru00220  Arginine biosynthesis
hru00330  Arginine and proline metabolism
hru01100  Metabolic pathways
hru01110  Biosynthesis of secondary metabolites
hru01130  Biosynthesis of antibiotics
hru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Halru_1449
   00330 Arginine and proline metabolism
    Halru_1449
Enzymes [BR:hru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Halru_1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase ASL_C2
Motif
Other DBs
NCBI-ProteinID: AGB16059
UniProt: L0IBC2
Position
1502454..1503374
Genome map
AA seq 306 aa AA seqDB search
MSRTVRIIGAPVDYGANRRGVDMGPSAIRYAGLAETLAAAGIEARDDGDLFVPRAEERDP
DAGTLDHENAKFIDEVQRACEHLGDRIEETLAEGEFPLVLGGDHSISIGTMHGASRDADL
GVVWFDAHADLNTPSTSPSGNVHGMPLAAALGYDEFADWDWANAPNVREESVAYVGLRSV
DEKEREAIRDSEMTAFTMADIDERGITAVVEDALAAATEGTDGLHVSLDLDWLDPSAAPG
VGTPVRGGVTYREAHSALEVVAEHAEAHDSLRSMDVVEVNPILDESNETASVATEIVASA
FGKRTI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaaccgtacgcattatcggtgccccagtcgattacggggcgaatcggcgcggt
gtggatatggggccgtcggcgatcaggtacgcgggactggctgagacgctggcggctgca
gggatcgaagcgcgagacgacggcgacctcttcgtcccccgcgcggaagaacgggatccg
gatgctggaacgctggatcacgagaacgcaaaattcatcgacgaggtccaacgtgcctgc
gagcacctcggcgatcgcatcgaggaaacacttgcagaaggggagtttccgctcgttctc
ggcggcgatcactcgatttcgatcgggacgatgcacggcgcgtcgcgggacgccgacctg
ggcgtggtctggttcgacgcccacgccgacctgaatacaccgtcgacctcgccaagtgga
aacgtccacgggatgccgctcgcagccgccctcggctacgacgagttcgccgactgggac
tgggcgaacgcaccaaacgtccgggaagagtcggtcgcgtacgtcggccttcggagcgtc
gacgagaaagaacgcgaggcgattcgcgacagcgagatgacggctttcactatggcggac
atcgacgaacgaggaatcacggcggtcgtcgaagacgcgcttgccgccgcgaccgaaggg
accgacggcctgcacgtcagcctcgacctcgactggctcgacccgtcggccgcacctggg
gtcgggacaccggtccgtggcggcgtcacgtaccgcgaggcccactcggcgctcgaggtt
gtcgccgaacacgccgaggcacacgactcgttgcgatcgatggacgtcgtcgaagtgaac
ccgatcttagacgagtcgaacgagaccgcctcggttgcgacggagatcgtcgccagtgcc
ttcggaaagcggactatctaa

DBGET integrated database retrieval system