KEGG   Halovivax ruber: Halru_2198Help
Entry
Halru_2198        CDS       T02402                                 

Definition
(GenBank) pterin-4a-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
hru  Halovivax ruber
Pathway
hru00790  Folate biosynthesis
hru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hru00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Halru_2198
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hru04147]
    Halru_2198
Enzymes [BR:hru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Halru_2198
Exosome [BR:hru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halru_2198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AGB16785
UniProt: L0IB63
Position
2235825..2236136
Genome map
AA seq 103 aa AA seqDB search
MADRLSDDEIAEQLPSSWQREGDEIVRVYEFTDYLHGVNFAQMVGEIAEAQFHHPEIIIR
FKEVEIRLTTHDEGGITDADIEMAEFIESEQTAQTGGIDDVEL
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccgactctctgacgacgaaatcgccgaacaactgccgagtagctggcaacgg
gagggtgacgagatcgttcgcgtctacgagttcaccgactacctccacggcgtcaacttc
gcccagatggtgggcgaaatcgccgaagcccagttccaccatcccgagatcatcatccgc
ttcaaagaggtcgaaatccgactgacgacccacgacgaaggtggaatcaccgacgcagac
atcgagatggccgagttcatcgaatccgagcagaccgcccagactggcggcatcgacgac
gtcgaactctga

DBGET integrated database retrieval system