KEGG   Halovivax ruber: Halru_2514Help
Entry
Halru_2514        CDS       T02402                                 

Definition
(GenBank) hypothetical protein
  KO
K16317  tRNA (pseudouridine54-N1)-methyltransferase [EC:2.1.1.257]
Organism
hru  Halovivax ruber
Brite
KEGG Orthology (KO) [BR:hru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hru03016]
    Halru_2514
Enzymes [BR:hru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.257  tRNA (pseudouridine54-N1)-methyltransferase
     Halru_2514
Transfer RNA biogenesis [BR:hru03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    Halru_2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltrn_RNA_2 Methyltrans_RNA
Motif
Other DBs
NCBI-ProteinID: AGB17095
UniProt: L0IBZ4
Position
complement(2539049..2539645)
Genome map
AA seq 198 aa AA seqDB search
MRQFVCLAHEVPTTPSFSLDDLAGGAGRLDALCRSLTAALLRSHGIREDVRVHLVLQDEL
TISVDGREVRRLNPDERSTAARIRTALEHRDEAIGALPAEPSPGFEVYRRGFAATLDELA
DEATIVHLHEDGDPLVVGPLPEEPAFVLSDHGDFTDAERETLAEYTDRRVRLGPHALHAD
QAITVAHHALDTDGYERF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagttcgtctgtctcgcccacgaggtgccgacgacgccgtcgttctcgctcgac
gacctcgcgggcggcgccggtcgcttggacgccctctgcagatcgttgacggccgccctc
ctgcgctcgcacggcatccgcgaagatgtccgcgtccacctcgtcctgcaggacgaactc
acgatctccgtcgacgggcgcgaggtccgccggctgaaccccgacgagcgctcgacggcc
gcccgcatcaggacggccctcgaacaccgcgacgaggccatcggcgcgctcccggccgaa
ccgagccccggcttcgaggtgtatcggcgcggcttcgcggcgacactcgacgagctcgcc
gacgaggcgacgatcgtccaccttcacgaggacggcgacccgctggtcgtgggcccgctc
cccgaggaaccggcgttcgtcctctccgatcacggcgacttcaccgacgccgaacgcgag
acgctcgccgagtacaccgatcgccgcgttcgtctgggtccgcacgcgctgcacgccgac
caggcgatcaccgtcgctcaccacgcgctcgacacggacggctacgagcgattctga

DBGET integrated database retrieval system